Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2076048..2076347 | Replicon | chromosome |
Accession | NC_017351 | ||
Organism | Staphylococcus aureus subsp. aureus 11819-97 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | MS7_RS15150 | Protein ID | WP_072353918.1 |
Coordinates | 2076171..2076347 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2076048..2076103 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MS7_RS10585 | 2071606..2071785 | + | 180 | WP_000669791.1 | hypothetical protein | - |
MS7_RS10595 | 2072096..2072356 | + | 261 | WP_001791826.1 | hypothetical protein | - |
MS7_RS10600 | 2072409..2072759 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
MS7_RS10605 | 2073270..2073605 | - | 336 | Protein_1987 | SH3 domain-containing protein | - |
MS7_RS10615 | 2074256..2074747 | - | 492 | WP_000920038.1 | staphylokinase | - |
MS7_RS10620 | 2074938..2075693 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
MS7_RS10625 | 2075705..2075959 | - | 255 | WP_000611512.1 | phage holin | - |
MS7_RS10630 | 2076011..2076118 | + | 108 | WP_001791821.1 | hypothetical protein | - |
- | 2076040..2076179 | + | 140 | NuclAT_0 | - | - |
- | 2076040..2076179 | + | 140 | NuclAT_0 | - | - |
- | 2076040..2076179 | + | 140 | NuclAT_0 | - | - |
- | 2076040..2076179 | + | 140 | NuclAT_0 | - | - |
- | 2076048..2076103 | + | 56 | - | - | Antitoxin |
MS7_RS15150 | 2076171..2076347 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
MS7_RS10640 | 2076490..2076864 | - | 375 | WP_000340977.1 | hypothetical protein | - |
MS7_RS10645 | 2076920..2077207 | - | 288 | WP_001262620.1 | hypothetical protein | - |
MS7_RS10650 | 2077253..2077405 | - | 153 | WP_001000058.1 | hypothetical protein | - |
MS7_RS10655 | 2077398..2081180 | - | 3783 | WP_000582128.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / hlb / groEL | 2072409..2124102 | 51693 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T26731 WP_072353918.1 NC_017351:c2076347-2076171 [Staphylococcus aureus subsp. aureus 11819-97]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T26731 NC_017351:c2076347-2076171 [Staphylococcus aureus subsp. aureus 11819-97]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGTTGGCATTACTGAAATCTTTAGAAAGGAGATGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTGATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT26731 NC_017351:2076048-2076103 [Staphylococcus aureus subsp. aureus 11819-97]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|