267303

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 344845..345431 Replicon chromosome
Accession NZ_CP115707
Organism Klebsiella pneumoniae strain CPE16

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag PGD48_RS01580 Protein ID WP_002920800.1
Coordinates 345063..345431 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag PGD48_RS01575 Protein ID WP_004174006.1
Coordinates 344845..345066 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
PGD48_RS01555 (341002) 341002..341928 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
PGD48_RS01560 (341925) 341925..343202 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
PGD48_RS01565 (343199) 343199..343966 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
PGD48_RS01570 (343968) 343968..344681 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
PGD48_RS01575 (344845) 344845..345066 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
PGD48_RS01580 (345063) 345063..345431 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
PGD48_RS01585 (345704) 345704..347020 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
PGD48_RS01590 (347127) 347127..348014 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
PGD48_RS01595 (348011) 348011..348856 + 846 WP_004181473.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
PGD48_RS01600 (348858) 348858..349928 + 1071 WP_043906884.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 341925..350665 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T267303 WP_002920800.1 NZ_CP115707:345063-345431 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT267303 WP_004174006.1 NZ_CP115707:344845-345066 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References