Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 1450304..1451094 | Replicon | chromosome |
Accession | NZ_CP115663 | ||
Organism | Pseudomonas putida strain PD584_L3 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | Q88NE5 |
Locus tag | PED35_RS06615 | Protein ID | WP_010952397.1 |
Coordinates | 1450304..1450771 (-) | Length | 156 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | I7C311 |
Locus tag | PED35_RS06620 | Protein ID | WP_014859917.1 |
Coordinates | 1450768..1451094 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PED35_RS06595 (PED35_06595) | 1445467..1446996 | + | 1530 | WP_010952395.1 | efflux transporter outer membrane subunit | - |
PED35_RS06600 (PED35_06600) | 1446993..1449170 | + | 2178 | WP_003251716.1 | FUSC family protein | - |
PED35_RS06605 (PED35_06605) | 1449160..1449360 | + | 201 | WP_003251718.1 | DUF1656 domain-containing protein | - |
PED35_RS06610 (PED35_06610) | 1449371..1450231 | + | 861 | WP_010952396.1 | HlyD family secretion protein | - |
PED35_RS06615 (PED35_06615) | 1450304..1450771 | - | 468 | WP_010952397.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
PED35_RS06620 (PED35_06620) | 1450768..1451094 | - | 327 | WP_014859917.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
PED35_RS06625 (PED35_06625) | 1451187..1451633 | - | 447 | WP_010952399.1 | universal stress protein | - |
PED35_RS06630 (PED35_06630) | 1451907..1452812 | + | 906 | WP_010952400.1 | LysR family transcriptional regulator | - |
PED35_RS06635 (PED35_06635) | 1452929..1454470 | + | 1542 | WP_010952401.1 | MFS transporter | - |
PED35_RS06640 (PED35_06640) | 1454499..1455560 | + | 1062 | WP_049587435.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17962.34 Da Isoelectric Point: 9.7963
>T267229 WP_010952397.1 NZ_CP115663:c1450771-1450304 [Pseudomonas putida]
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTKRNTFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWINDESSKRAYESSDDAYKVFQKMLHSGNPPDDWDQLLQEAAAD
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTKRNTFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWINDESSKRAYESSDDAYKVFQKMLHSGNPPDDWDQLLQEAAAD
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|