Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
Location | 1448563..1449353 | Replicon | chromosome |
Accession | NZ_CP115661 | ||
Organism | Pseudomonas putida strain PD689_delTT1 |
Toxin (Protein)
Gene name | yhaV | Uniprot ID | Q88NE5 |
Locus tag | PED36_RS06620 | Protein ID | WP_010952397.1 |
Coordinates | 1448563..1449030 (-) | Length | 156 a.a. |
Antitoxin (Protein)
Gene name | prlF | Uniprot ID | I7C311 |
Locus tag | PED36_RS06625 | Protein ID | WP_014859917.1 |
Coordinates | 1449027..1449353 (-) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PED36_RS06600 (PED36_06600) | 1443726..1445255 | + | 1530 | WP_010952395.1 | efflux transporter outer membrane subunit | - |
PED36_RS06605 (PED36_06605) | 1445252..1447429 | + | 2178 | WP_003251716.1 | FUSC family protein | - |
PED36_RS06610 (PED36_06610) | 1447419..1447619 | + | 201 | WP_003251718.1 | DUF1656 domain-containing protein | - |
PED36_RS06615 (PED36_06615) | 1447630..1448490 | + | 861 | WP_010952396.1 | HlyD family secretion protein | - |
PED36_RS06620 (PED36_06620) | 1448563..1449030 | - | 468 | WP_010952397.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
PED36_RS06625 (PED36_06625) | 1449027..1449353 | - | 327 | WP_014859917.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
PED36_RS06630 (PED36_06630) | 1449446..1449892 | - | 447 | WP_010952399.1 | universal stress protein | - |
PED36_RS06635 (PED36_06635) | 1450166..1451071 | + | 906 | WP_010952400.1 | LysR family transcriptional regulator | - |
PED36_RS06640 (PED36_06640) | 1451188..1452729 | + | 1542 | WP_010952401.1 | MFS transporter | - |
PED36_RS06645 (PED36_06645) | 1452758..1453819 | + | 1062 | WP_049587435.1 | HlyD family secretion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 156 a.a. Molecular weight: 17962.34 Da Isoelectric Point: 9.7963
>T267222 WP_010952397.1 NZ_CP115661:c1449030-1448563 [Pseudomonas putida]
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTKRNTFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWINDESSKRAYESSDDAYKVFQKMLHSGNPPDDWDQLLQEAAAD
MSDASRKPLVIHGWTVIAHPLFLAKLDALSAQVEAQRDKDPTGYTKRNTFKRLAAIRRLAFDVIPQDPTKPEYRQGATLG
GDHKHWFRAKFFQQYRLFFRYHTPSRIIVLAWINDESSKRAYESSDDAYKVFQKMLHSGNPPDDWDQLLQEAAAD
Download Length: 468 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|