Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 1372679..1373280 | Replicon | chromosome |
| Accession | NZ_CP115661 | ||
| Organism | Pseudomonas putida strain PD689_delTT1 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A2L1IAQ2 |
| Locus tag | PED36_RS06260 | Protein ID | WP_049587984.1 |
| Coordinates | 1372966..1373280 (-) | Length | 105 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A2L1IAR7 |
| Locus tag | PED36_RS06255 | Protein ID | WP_049587986.1 |
| Coordinates | 1372679..1372966 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PED36_RS06235 (PED36_06235) | 1367711..1368556 | + | 846 | WP_003254799.1 | DUF6502 family protein | - |
| PED36_RS06240 (PED36_06240) | 1368553..1370271 | + | 1719 | WP_010952348.1 | DUF5666 domain-containing protein | - |
| PED36_RS06245 (PED36_06245) | 1370326..1371075 | + | 750 | WP_049587988.1 | hypothetical protein | - |
| PED36_RS06250 (PED36_06250) | 1371147..1372478 | - | 1332 | WP_004576169.1 | 30S ribosomal protein S12 methylthiotransferase RimO | - |
| PED36_RS06255 (PED36_06255) | 1372679..1372966 | - | 288 | WP_049587986.1 | helix-turn-helix domain-containing protein | Antitoxin |
| PED36_RS06260 (PED36_06260) | 1372966..1373280 | - | 315 | WP_049587984.1 | hypothetical protein | Toxin |
| PED36_RS06265 (PED36_06265) | 1373729..1375639 | + | 1911 | WP_010952353.1 | potassium transporter Kup | - |
| PED36_RS06270 (PED36_06270) | 1375688..1376980 | - | 1293 | WP_010952354.1 | AcvB/VirJ family lysyl-phosphatidylglycerol hydrolase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 11784.61 Da Isoelectric Point: 9.9097
>T267221 WP_049587984.1 NZ_CP115661:c1373280-1372966 [Pseudomonas putida]
MIFIETPVFTSDLKEHLDDEEYRALQAYLAEHPEAGSLLEETGGLRKIRWAAKGKGKSGGVRVIYYHVTAAHQIRMILIY
RKGIVDTLTSSQKAQLRALNKGWK
MIFIETPVFTSDLKEHLDDEEYRALQAYLAEHPEAGSLLEETGGLRKIRWAAKGKGKSGGVRVIYYHVTAAHQIRMILIY
RKGIVDTLTSSQKAQLRALNKGWK
Download Length: 315 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2L1IAQ2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2L1IAR7 |