Detailed information of TA system
Overview
TA module
Type | I | Classification (family/domain) | SprA2-SprA2AS/- |
Location | 2440806..2440990 | Replicon | chromosome |
Accession | NC_017349 | ||
Organism | Staphylococcus aureus subsp. aureus LGA251 |
Toxin (Protein)
Gene name | SprA2 | Uniprot ID | A0A2P7CQJ7 |
Locus tag | SARLGA251_RS12250 | Protein ID | WP_000482647.1 |
Coordinates | 2440883..2440990 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | SprA2AS | ||
Locus tag | - | ||
Coordinates | 2440806..2440866 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SARLGA251_RS12225 | 2436260..2436427 | - | 168 | WP_031927726.1 | hypothetical protein | - |
SARLGA251_RS12235 | 2436658..2438391 | - | 1734 | WP_000486497.1 | ABC transporter ATP-binding protein/permease | - |
SARLGA251_RS12240 | 2438416..2440179 | - | 1764 | WP_001064840.1 | ABC transporter ATP-binding protein/permease | - |
- | 2440806..2440866 | + | 61 | - | - | Antitoxin |
SARLGA251_RS12250 | 2440883..2440990 | - | 108 | WP_000482647.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
SARLGA251_RS12255 | 2441124..2441510 | - | 387 | WP_000779353.1 | flippase GtxA | - |
SARLGA251_RS12260 | 2441778..2442920 | + | 1143 | WP_001176867.1 | glycerate kinase | - |
SARLGA251_RS12265 | 2442980..2443639 | + | 660 | WP_000831298.1 | membrane protein | - |
SARLGA251_RS12270 | 2443822..2445033 | + | 1212 | WP_001191927.1 | multidrug effflux MFS transporter | - |
SARLGA251_RS12275 | 2445156..2445629 | - | 474 | WP_000456493.1 | GyrI-like domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4012.76 Da Isoelectric Point: 10.4935
>T26722 WP_000482647.1 NC_017349:c2440990-2440883 [Staphylococcus aureus subsp. aureus LGA251]
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
MFNLLIDIMTSALSGCLVAFFAHWLRTRNNKKGDK
Download Length: 108 bp
>T26722 NC_017349:c2440990-2440883 [Staphylococcus aureus subsp. aureus LGA251]
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
ATGTTCAATTTATTAATTGACATCATGACTTCAGCTTTAAGCGGCTGTCTTGTTGCGTTTTTTGCACATTGGTTACGAAC
GCGCAACAATAAAAAAGGTGACAAATAA
Antitoxin
Download Length: 61 bp
>AT26722 NC_017349:2440806-2440866 [Staphylococcus aureus subsp. aureus LGA251]
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
TACATAATAAATTGAACATCTAAATACACCAAATCCCCTCACTACTGCCATAGTGAGGGGA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|