Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/HigB-HTH_XRE
Location 3374824..3375490 Replicon chromosome
Accession NZ_CP115659
Organism Kosakonia oryzendophytica strain FY-07

Toxin (Protein)


Gene name higB Uniprot ID A0A1C4B1C0
Locus tag O9K67_RS16375 Protein ID WP_061494634.1
Coordinates 3375188..3375490 (-) Length 101 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID A0A1C4B1H8
Locus tag O9K67_RS16370 Protein ID WP_061494635.1
Coordinates 3374824..3375165 (-) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O9K67_RS16335 (O9K67_16335) 3369846..3370166 - 321 WP_061494642.1 heavy metal-binding domain-containing protein -
O9K67_RS16340 (O9K67_16340) 3370269..3370784 + 516 WP_061494641.1 lipoprotein -
O9K67_RS16345 (O9K67_16345) 3370994..3371722 + 729 WP_061494640.1 arginine ABC transporter ATP-binding protein ArtP -
O9K67_RS16350 (O9K67_16350) 3371742..3372473 + 732 WP_061494639.1 arginine ABC transporter substrate-binding protein ArtI -
O9K67_RS16355 (O9K67_16355) 3372480..3373196 + 717 WP_061494638.1 arginine ABC transporter permease ArtQ -
O9K67_RS16360 (O9K67_16360) 3373196..3373864 + 669 WP_061494637.1 arginine ABC transporter permease ArtM -
O9K67_RS16365 (O9K67_16365) 3374036..3374767 + 732 WP_061494636.1 arginine ABC transporter substrate-binding protein ArtJ -
O9K67_RS16370 (O9K67_16370) 3374824..3375165 - 342 WP_061494635.1 HigA family addiction module antitoxin Antitoxin
O9K67_RS16375 (O9K67_16375) 3375188..3375490 - 303 WP_061494634.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O9K67_RS16380 (O9K67_16380) 3375561..3376688 - 1128 WP_061494633.1 23S rRNA (uracil(747)-C(5))-methyltransferase RlmC -
O9K67_RS16385 (O9K67_16385) 3376730..3377200 - 471 WP_061494632.1 YbjO family protein -
O9K67_RS16390 (O9K67_16390) 3377275..3378120 - 846 WP_061494631.1 putrescine ABC transporter permease PotI -
O9K67_RS16395 (O9K67_16395) 3378117..3379070 - 954 WP_061494630.1 putrescine ABC transporter permease PotH -
O9K67_RS16400 (O9K67_16400) 3379080..3380213 - 1134 WP_061494629.1 putrescine ABC transporter ATP-binding subunit PotG -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-1

(7-99)

Antitoxin

Cro/C1-type helix-turn-helix domain

(16-70)


Sequences

Toxin        


Download         Length: 101 a.a.        Molecular weight: 11767.55 Da        Isoelectric Point: 10.1295

>T267217 WP_061494634.1 NZ_CP115659:c3375490-3375188 [Kosakonia oryzendophytica]
MPKKISIACFRDPWLEAFFHHTAQHRKIPVDIHTVLSRKLDIINAATSHRDLRSPPGNRYEELSGKLHGYSSIRVNKQYR
LIFKWVNGKAEDLYLDPHIY

Download         Length: 303 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12997.81 Da        Isoelectric Point: 5.2157

>AT267217 WP_061494635.1 NZ_CP115659:c3375165-3374824 [Kosakonia oryzendophytica]
MKPASRKPTTVGDILLYEYLEPLDLRINELAEMLHVHRNSVSALVNNNRRLTTDMAFRLARVFDTSVDFWINLQAAVDLW
DVENDTRVQEELSRIEPAAEFIARREAGTKKVA

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1C4B1C0

Antitoxin

Source ID Structure
AlphaFold DB A0A1C4B1H8

References