Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 24698..25356 | Replicon | plasmid unnamed1 |
Accession | NZ_CP115630 | ||
Organism | Acinetobacter baumannii strain 2022CK-00337 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PF547_RS19715 | Protein ID | WP_000312250.1 |
Coordinates | 24997..25356 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PF547_RS19710 | Protein ID | WP_001096429.1 |
Coordinates | 24698..24997 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF547_RS19675 (PF547_19675) | 20756..21013 | + | 258 | WP_000834292.1 | hypothetical protein | - |
PF547_RS19680 (PF547_19680) | 21018..21590 | + | 573 | WP_000429351.1 | hypothetical protein | - |
PF547_RS19685 (PF547_19685) | 21566..21745 | + | 180 | WP_002081921.1 | hypothetical protein | - |
PF547_RS19690 (PF547_19690) | 21762..22391 | + | 630 | WP_002081923.1 | hypothetical protein | - |
PF547_RS19695 (PF547_19695) | 22431..22940 | + | 510 | WP_001043199.1 | hypothetical protein | - |
PF547_RS19700 (PF547_19700) | 23021..23575 | + | 555 | WP_000790086.1 | hypothetical protein | - |
PF547_RS19705 (PF547_19705) | 23625..24161 | + | 537 | WP_000731977.1 | hypothetical protein | - |
PF547_RS19710 (PF547_19710) | 24698..24997 | - | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
PF547_RS19715 (PF547_19715) | 24997..25356 | - | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PF547_RS19720 (PF547_19720) | 25557..26123 | + | 567 | WP_031948745.1 | hypothetical protein | - |
PF547_RS19725 (PF547_19725) | 26172..26354 | + | 183 | WP_000373384.1 | hypothetical protein | - |
PF547_RS19730 (PF547_19730) | 26421..27119 | + | 699 | WP_000873188.1 | hypothetical protein | - |
PF547_RS19735 (PF547_19735) | 27257..27640 | + | 384 | WP_000654347.1 | hypothetical protein | - |
PF547_RS19740 (PF547_19740) | 27707..28465 | + | 759 | WP_001053130.1 | hypothetical protein | - |
PF547_RS19745 (PF547_19745) | 28517..28852 | + | 336 | WP_000654055.1 | hypothetical protein | - |
PF547_RS19750 (PF547_19750) | 29719..30033 | + | 315 | WP_000708713.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..71233 | 71233 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T267199 WP_000312250.1 NZ_CP115630:c25356-24997 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|