Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 26769..27427 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP115627 | ||
| Organism | Acinetobacter baumannii strain 2022CK-00185 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | PF515_RS19055 | Protein ID | WP_000312250.1 |
| Coordinates | 27068..27427 (-) | Length | 120 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PF515_RS19050 | Protein ID | WP_001096429.1 |
| Coordinates | 26769..27068 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PF515_RS19015 (PF515_19015) | 21935..22564 | + | 630 | WP_000701002.1 | hypothetical protein | - |
| PF515_RS19020 (PF515_19020) | 22604..23113 | + | 510 | WP_038350457.1 | hypothetical protein | - |
| PF515_RS19025 (PF515_19025) | 23195..23707 | + | 513 | WP_000840065.1 | hypothetical protein | - |
| PF515_RS19030 (PF515_19030) | 23763..24092 | + | 330 | WP_000459117.1 | hypothetical protein | - |
| PF515_RS19035 (PF515_19035) | 24129..24857 | + | 729 | WP_001022819.1 | hypothetical protein | - |
| PF515_RS19040 (PF515_19040) | 25093..25647 | + | 555 | WP_000790082.1 | hypothetical protein | - |
| PF515_RS19045 (PF515_19045) | 25697..26233 | + | 537 | WP_000732006.1 | hypothetical protein | - |
| PF515_RS19050 (PF515_19050) | 26769..27068 | - | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
| PF515_RS19055 (PF515_19055) | 27068..27427 | - | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| PF515_RS19060 (PF515_19060) | 27628..28194 | + | 567 | WP_000710385.1 | hypothetical protein | - |
| PF515_RS19065 (PF515_19065) | 28243..28425 | + | 183 | WP_000373385.1 | hypothetical protein | - |
| PF515_RS19070 (PF515_19070) | 28492..29190 | + | 699 | WP_000873188.1 | hypothetical protein | - |
| PF515_RS19075 (PF515_19075) | 29329..29712 | + | 384 | WP_000654348.1 | hypothetical protein | - |
| PF515_RS19080 (PF515_19080) | 29779..30537 | + | 759 | WP_001053128.1 | hypothetical protein | - |
| PF515_RS19085 (PF515_19085) | 30589..30924 | + | 336 | WP_000653925.1 | hypothetical protein | - |
| PF515_RS19090 (PF515_19090) | 31788..32102 | + | 315 | WP_000708715.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..71598 | 71598 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T267196 WP_000312250.1 NZ_CP115627:c27427-27068 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|