Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 26769..27427 | Replicon | plasmid unnamed1 |
Accession | NZ_CP115624 | ||
Organism | Acinetobacter baumannii strain 2022CK-00340 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PF449_RS19215 | Protein ID | WP_000312250.1 |
Coordinates | 27068..27427 (-) | Length | 120 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PF449_RS19210 | Protein ID | WP_001096429.1 |
Coordinates | 26769..27068 (-) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PF449_RS19175 (PF449_19175) | 21935..22564 | + | 630 | WP_000701002.1 | hypothetical protein | - |
PF449_RS19180 (PF449_19180) | 22604..23113 | + | 510 | WP_038350457.1 | hypothetical protein | - |
PF449_RS19185 (PF449_19185) | 23195..23707 | + | 513 | WP_000840065.1 | hypothetical protein | - |
PF449_RS19190 (PF449_19190) | 23763..24092 | + | 330 | WP_000459117.1 | hypothetical protein | - |
PF449_RS19195 (PF449_19195) | 24129..24857 | + | 729 | WP_001022819.1 | hypothetical protein | - |
PF449_RS19200 (PF449_19200) | 25093..25647 | + | 555 | WP_000790082.1 | hypothetical protein | - |
PF449_RS19205 (PF449_19205) | 25697..26233 | + | 537 | WP_000732006.1 | hypothetical protein | - |
PF449_RS19210 (PF449_19210) | 26769..27068 | - | 300 | WP_001096429.1 | XRE family transcriptional regulator | Antitoxin |
PF449_RS19215 (PF449_19215) | 27068..27427 | - | 360 | WP_000312250.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PF449_RS19220 (PF449_19220) | 27628..28194 | + | 567 | WP_000710385.1 | hypothetical protein | - |
PF449_RS19225 (PF449_19225) | 28243..28425 | + | 183 | WP_000373385.1 | hypothetical protein | - |
PF449_RS19230 (PF449_19230) | 28492..29190 | + | 699 | WP_000873188.1 | hypothetical protein | - |
PF449_RS19235 (PF449_19235) | 29329..29712 | + | 384 | WP_000654348.1 | hypothetical protein | - |
PF449_RS19240 (PF449_19240) | 29779..30537 | + | 759 | WP_001053128.1 | hypothetical protein | - |
PF449_RS19245 (PF449_19245) | 30589..30924 | + | 336 | WP_000653925.1 | hypothetical protein | - |
PF449_RS19250 (PF449_19250) | 31788..32102 | + | 315 | WP_000708715.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..71598 | 71598 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 120 a.a. Molecular weight: 13751.62 Da Isoelectric Point: 4.8212
>T267193 WP_000312250.1 NZ_CP115624:c27427-27068 [Acinetobacter baumannii]
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
MAWDVETTELFDSWLAEQDENAQDKILASLLVLSELGPNLGRPHVDTIKESKYPNMKEIRVQVKGHPIRGFFAFDPERKA
IVLCAGDKKGLNEKAFYKEMIKIADEQYEQYLRDNYGDK
Download Length: 360 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|