Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4833621..4834375 | Replicon | chromosome |
| Accession | NZ_CP115551 | ||
| Organism | Salmonella enterica subsp. enterica serovar Bispebjerg strain 20SAL-1342-3 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | B5F003 |
| Locus tag | PEE20_RS24095 | Protein ID | WP_000558166.1 |
| Coordinates | 4833621..4833932 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | PEE20_RS24100 | Protein ID | WP_001259011.1 |
| Coordinates | 4833929..4834375 (+) | Length | 149 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PEE20_RS24065 (4829279) | 4829279..4830181 | + | 903 | WP_000331364.1 | formate dehydrogenase subunit beta | - |
| PEE20_RS24070 (4830178) | 4830178..4830813 | + | 636 | WP_000829025.1 | formate dehydrogenase cytochrome b556 subunit | - |
| PEE20_RS24075 (4830810) | 4830810..4831739 | + | 930 | WP_000027730.1 | formate dehydrogenase accessory protein FdhE | - |
| PEE20_RS24080 (4831786) | 4831786..4832076 | - | 291 | WP_000362050.1 | DNA-binding transcriptional regulator | - |
| PEE20_RS24085 (4832077) | 4832077..4832388 | - | 312 | WP_001159630.1 | cytotoxic translational repressor of toxin-antitoxin stability system | - |
| PEE20_RS24090 (4832606) | 4832606..4833535 | + | 930 | WP_151117748.1 | alpha/beta hydrolase | - |
| PEE20_RS24095 (4833621) | 4833621..4833932 | + | 312 | WP_000558166.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| PEE20_RS24100 (4833929) | 4833929..4834375 | + | 447 | WP_001259011.1 | type II toxin-antitoxin system HigA family antitoxin | Antitoxin |
| PEE20_RS24105 (4834390) | 4834390..4835331 | - | 942 | WP_001518251.1 | fatty acid biosynthesis protein FabY | - |
| PEE20_RS24110 (4835376) | 4835376..4835813 | - | 438 | WP_000560969.1 | D-aminoacyl-tRNA deacylase | - |
| PEE20_RS24115 (4835810) | 4835810..4836682 | - | 873 | WP_000921423.1 | virulence factor BrkB family protein | - |
| PEE20_RS24120 (4836676) | 4836676..4837275 | - | 600 | WP_000965695.1 | glucose-1-phosphatase | - |
| PEE20_RS24125 (4837466) | 4837466..4838269 | - | 804 | WP_000059694.1 | DeoR/GlpR family DNA-binding transcription regulator | - |
| PEE20_RS24130 (4838303) | 4838303..4839199 | - | 897 | WP_001520529.1 | sugar kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12432.40 Da Isoelectric Point: 9.5334
>T267187 WP_000558166.1 NZ_CP115551:4833621-4833932 [Salmonella enterica subsp. enterica serovar Bispebjerg]
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
VHVISRKPFNEAMLMYPNHELALTELLNVLEKKTFTQPEEMKRYIPSLDNFKYRDKWWVIDVSGNSLRLISYIDFRLHKI
FVKHIVSHAEYDKLTAYYRGNKE
Download Length: 312 bp
Antitoxin
Download Length: 149 a.a. Molecular weight: 16734.08 Da Isoelectric Point: 6.6451
>AT267187 WP_001259011.1 NZ_CP115551:4833929-4834375 [Salmonella enterica subsp. enterica serovar Bispebjerg]
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
MRTHRQMDATSAKKIVDTFSDAVKTVPLMGEDRNDNEYRRALALVEFLVDHDDLENPLFELLCARISEYEKHAPEFKALN
QHLEKTPPGVSVLRTLMDQYGLKAADLANELGSKSNVSNILNGRRALTVNHIKALTQRFKLPADAFIE
Download Length: 447 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|