Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-VapI |
Location | 1443540..1444195 | Replicon | chromosome |
Accession | NZ_CP115461 | ||
Organism | Coxiella burnetii strain RMSFV |
Toxin (Protein)
Gene name | graT | Uniprot ID | Q83BL3 |
Locus tag | PDI63_RS08050 | Protein ID | WP_010958264.1 |
Coordinates | 1443857..1444195 (-) | Length | 113 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PDI63_RS08045 | Protein ID | WP_010958263.1 |
Coordinates | 1443540..1443851 (-) | Length | 104 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PDI63_RS08025 | 1438818..1439495 | - | 678 | WP_010958258.1 | cyclin family protein | - |
PDI63_RS08030 | 1439813..1441195 | - | 1383 | WP_010958260.1 | cysteine--tRNA ligase | - |
PDI63_RS08035 | 1441186..1442583 | - | 1398 | WP_010958261.1 | glutamate--tRNA ligase | - |
PDI63_RS08040 | 1442740..1443471 | + | 732 | WP_010958262.1 | UDP-2,3-diacylglucosamine diphosphatase | - |
PDI63_RS08045 | 1443540..1443851 | - | 312 | WP_010958263.1 | HigA family addiction module antitoxin | Antitoxin |
PDI63_RS08050 | 1443857..1444195 | - | 339 | WP_010958264.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PDI63_RS08055 | 1444554..1445699 | + | 1146 | WP_010957722.1 | ISAs1-like element ISCbu1 family transposase | - |
PDI63_RS08060 | 1446027..1447700 | + | 1674 | WP_010958265.1 | CBU_1493 family Dot/Icm T4SS effector | - |
PDI63_RS08065 | 1447874..1448629 | - | 756 | WP_010958266.1 | pyridoxine 5'-phosphate synthase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 1444554..1445699 | 1145 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 113 a.a. Molecular weight: 13409.66 Da Isoelectric Point: 10.4588
>T267157 WP_010958264.1 NZ_CP115461:c1444195-1443857 [Coxiella burnetii]
MPLTLYIMLDVTRKTVILEVIIKSFKDKYTKYLYKGVSVSKWQAIRKQAERRLQILDSVTSLDDLRSLPSNRFESLRGNR
KGQFSIRINKQWRICFKWINNEPTEVEIVDYH
MPLTLYIMLDVTRKTVILEVIIKSFKDKYTKYLYKGVSVSKWQAIRKQAERRLQILDSVTSLDDLRSLPSNRFESLRGNR
KGQFSIRINKQWRICFKWINNEPTEVEIVDYH
Download Length: 339 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|