Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/PIN-PHD |
Location | 3803417..3804084 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | O50411 |
Locus tag | PAK35_RS17850 | Protein ID | WP_003417916.1 |
Coordinates | 3803417..3803809 (-) | Length | 131 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A0E8U8S7 |
Locus tag | PAK35_RS17855 | Protein ID | WP_003912214.1 |
Coordinates | 3803809..3804084 (-) | Length | 92 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS17830 (PAK35_17830) | 3799264..3800253 | - | 990 | WP_003417912.1 | 4-hydroxy-3-methylbut-2-enyl diphosphate reductase | - |
PAK35_RS17835 (PAK35_17835) | 3800253..3800642 | - | 390 | Protein_3523 | polyprenyl synthetase family protein | - |
PAK35_RS17840 (PAK35_17840) | 3800695..3801956 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
PAK35_RS17845 (PAK35_17845) | 3801998..3802663 | - | 666 | Protein_3525 | polyprenyl synthetase family protein | - |
PAK35_RS17850 (PAK35_17850) | 3803417..3803809 | - | 393 | WP_003417916.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
PAK35_RS17855 (PAK35_17855) | 3803809..3804084 | - | 276 | WP_003912214.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
PAK35_RS17860 (PAK35_17860) | 3804266..3805637 | + | 1372 | Protein_3528 | ISNCY family transposase | - |
PAK35_RS17865 (PAK35_17865) | 3805827..3808004 | + | 2178 | WP_016330440.1 | PE family protein | - |
PAK35_RS17870 (PAK35_17870) | 3808075..3808947 | - | 873 | WP_003906098.1 | 3-hydroxyacyl-thioester dehydratase HtdY | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | IScluster/Tn | - | - | 3800695..3805637 | 4942 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 131 a.a. Molecular weight: 14316.74 Da Isoelectric Point: 10.7249
>T267144 WP_003417916.1 NZ_CP115447:c3803809-3803417 [Mycobacterium tuberculosis]
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
MAAIYLDSSAIVKLAVREPESDALRRYLRTRHPRVSSALARAEVMRALLDKGESARKAGRRALAHLDLLRVDKRVLDLAG
GLLPFELRTLDAIHLATAQRLGVDLGRLCTYDDRMRDAAKTLGMAVIAPS
Download Length: 393 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BXS8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E8U8S7 |