Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2260802..2261019 | Replicon | chromosome |
| Accession | NC_017347 | ||
| Organism | Staphylococcus aureus subsp. aureus T0131 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | SAT0131_RS11505 | Protein ID | WP_001802298.1 |
| Coordinates | 2260915..2261019 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF4 | ||
| Locus tag | - | ||
| Coordinates | 2260802..2260857 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SAT0131_RS11485 | 2256939..2257604 | - | 666 | WP_001024094.1 | SDR family oxidoreductase | - |
| SAT0131_RS11490 | 2257756..2258076 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| SAT0131_RS11495 | 2258078..2259058 | + | 981 | WP_000019744.1 | CDF family zinc efflux transporter CzrB | - |
| SAT0131_RS11500 | 2259324..2260415 | + | 1092 | WP_000495671.1 | lytic regulatory protein | - |
| - | 2260802..2260857 | + | 56 | - | - | Antitoxin |
| SAT0131_RS11505 | 2260915..2261019 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| SAT0131_RS15815 | 2261180..2261663 | - | 484 | Protein_2190 | recombinase family protein | - |
| SAT0131_RS11515 | 2261706..2262842 | - | 1137 | WP_000115564.1 | SAP domain-containing protein | - |
| SAT0131_RS11520 | 2263131..2263223 | + | 93 | WP_031872195.1 | hypothetical protein | - |
| SAT0131_RS11525 | 2263418..2264590 | - | 1173 | WP_000195429.1 | IS256-like element IS256 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 2263418..2264590 | 1172 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T26712 WP_001802298.1 NC_017347:c2261019-2260915 [Staphylococcus aureus subsp. aureus T0131]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T26712 NC_017347:c2261019-2260915 [Staphylococcus aureus subsp. aureus T0131]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTTATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT26712 NC_017347:2260802-2260857 [Staphylococcus aureus subsp. aureus T0131]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|