Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 2039363..2040282 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | HigB2 | Uniprot ID | L7N4R2 |
Locus tag | PAK35_RS09405 | Protein ID | WP_003900449.1 |
Coordinates | 2039677..2040282 (-) | Length | 202 a.a. |
Antitoxin (Protein)
Gene name | HigA2 | Uniprot ID | L7N5K9 |
Locus tag | PAK35_RS09400 | Protein ID | WP_003410124.1 |
Coordinates | 2039363..2039668 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS09365 (PAK35_09365) | 2034824..2035201 | + | 378 | Protein_1857 | hypothetical protein | - |
PAK35_RS09370 (PAK35_09370) | 2035198..2036238 | + | 1041 | WP_003410103.1 | ImmA/IrrE family metallo-endopeptidase | - |
PAK35_RS09375 (PAK35_09375) | 2036480..2037199 | + | 720 | WP_003410108.1 | DUF433 domain-containing protein | - |
PAK35_RS09380 (PAK35_09380) | 2037189..2037419 | + | 231 | Protein_1860 | hypothetical protein | - |
PAK35_RS09390 (PAK35_09390) | 2038775..2038963 | + | 189 | Protein_1862 | hypothetical protein | - |
PAK35_RS09395 (PAK35_09395) | 2038979..2039278 | - | 300 | WP_003410120.1 | hypothetical protein | - |
PAK35_RS09400 (PAK35_09400) | 2039363..2039668 | - | 306 | WP_003410124.1 | XRE family transcriptional regulator | Antitoxin |
PAK35_RS09405 (PAK35_09405) | 2039677..2040282 | - | 606 | WP_003900449.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PAK35_RS09410 (PAK35_09410) | 2040307..2040666 | - | 360 | WP_003410131.1 | hypothetical protein | - |
PAK35_RS09415 (PAK35_09415) | 2040826..2041479 | - | 654 | WP_057331469.1 | hypothetical protein | - |
PAK35_RS09420 (PAK35_09420) | 2041455..2041691 | - | 237 | WP_003410133.1 | hypothetical protein | - |
PAK35_RS09425 (PAK35_09425) | 2041898..2042794 | - | 897 | WP_003410136.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2033512..2047798 | 14286 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 202 a.a. Molecular weight: 22744.96 Da Isoelectric Point: 7.3073
>T267114 WP_003900449.1 NZ_CP115447:c2040282-2039677 [Mycobacterium tuberculosis]
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
VNVPWENAHGGALYCLIRGDEFSAWHRLLFQRPGCAESVLACRHFLDGSPVARCSYPEEYHPCVISRIALLCDSVGWTAD
VERISAWLNGLDRETYELVFAAIEVLEEEGPALGCPLVDTVRGSRHKNMKELRPGSQGRSEVRILFAFDPARQAIMLAAG
NKAGRWTQWYDEKIKAADEMFAEHLAQFEDTKPKRRKRKKG
Download Length: 606 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4BV20 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 7EWC | |
PDB | 7EWD | |
PDB | 7EWE | |
AlphaFold DB | A0A7U4BV30 |