Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Gp49-HTH_37 |
Location | 1968823..1969691 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | higB | Uniprot ID | P9WJA4 |
Locus tag | PAK35_RS08985 | Protein ID | WP_010886136.1 |
Coordinates | 1968823..1969200 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0TLM0 |
Locus tag | PAK35_RS08990 | Protein ID | WP_003409886.1 |
Coordinates | 1969242..1969691 (+) | Length | 150 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS08935 (PAK35_08935) | 1964612..1965064 | - | 453 | WP_003899095.1 | lipoprotein | - |
PAK35_RS08940 (PAK35_08940) | 1965128..1965529 | + | 402 | WP_003409869.1 | hypothetical protein | - |
PAK35_RS08945 (PAK35_08945) | 1965522..1965704 | - | 183 | WP_003409870.1 | hypothetical protein | - |
PAK35_RS08950 (PAK35_08950) | 1965818..1966168 | - | 351 | WP_003409871.1 | hypothetical protein | - |
PAK35_RS08955 (PAK35_08955) | 1966179..1967081 | - | 903 | WP_003899097.1 | hypothetical protein | - |
PAK35_RS08960 (PAK35_08960) | 1967102..1967293 | - | 192 | WP_003409876.1 | hypothetical protein | - |
PAK35_RS08965 (PAK35_08965) | 1967294..1967590 | - | 297 | WP_003409877.1 | hypothetical protein | - |
PAK35_RS08970 (PAK35_08970) | 1967830..1968045 | + | 216 | WP_003409878.1 | antitoxin | - |
PAK35_RS08975 (PAK35_08975) | 1968042..1968353 | + | 312 | WP_003409881.1 | type II toxin-antitoxin system VapC family toxin | - |
PAK35_RS08980 (PAK35_08980) | 1968327..1968848 | - | 522 | WP_003904745.1 | hypothetical protein | - |
PAK35_RS08985 (PAK35_08985) | 1968823..1969200 | + | 378 | WP_010886136.1 | type II toxin-antitoxin system toxin HigB | Toxin |
PAK35_RS08990 (PAK35_08990) | 1969242..1969691 | + | 450 | WP_003409886.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
PAK35_RS08995 (PAK35_08995) | 1969688..1970233 | + | 546 | WP_003409891.1 | SecB-like chaperone | - |
PAK35_RS09000 (PAK35_09000) | 1970122..1970736 | - | 615 | WP_003901296.1 | hypothetical protein | - |
PAK35_RS09005 (PAK35_09005) | 1970785..1971081 | - | 297 | WP_003409896.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
PAK35_RS09010 (PAK35_09010) | 1971078..1971329 | - | 252 | WP_003409899.1 | type II toxin-antitoxin system ParD family antitoxin | - |
PAK35_RS09015 (PAK35_09015) | 1971316..1971810 | + | 495 | WP_003899099.1 | hypothetical protein | - |
PAK35_RS09020 (PAK35_09020) | 1971970..1972377 | - | 408 | WP_003409913.1 | type II toxin-antitoxin system VapC family toxin | - |
PAK35_RS09025 (PAK35_09025) | 1972381..1972653 | - | 273 | WP_003899100.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
PAK35_RS09030 (PAK35_09030) | 1972686..1973906 | - | 1221 | WP_003409919.1 | TetR family transcriptional regulator Mce3R | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14397.77 Da Isoelectric Point: 10.8862
>T267108 WP_010886136.1 NZ_CP115447:1968823-1969200 [Mycobacterium tuberculosis]
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
VPPPDPAAMGTWKFFRASVDGRPVFKKEFDKLPDQARAALIVLMQRYLVGDLAAGSIKPIRGDILELRWHEANNHFRVLF
FRWGQHPVALTAFYKNQQKTPKTKIETALDRQKIWKRAFGDTPPI
Download Length: 378 bp
Antitoxin
Download Length: 150 a.a. Molecular weight: 16760.16 Da Isoelectric Point: 8.0771
>AT267108 WP_003409886.1 NZ_CP115447:1969242-1969691 [Mycobacterium tuberculosis]
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
MSIDFPLGDDLAGYIAEAIAADPSFKGTLEDAEEARRLVDALIALRKHCQLSQVEVAKRMGVRQPTVSGFEKEPSDPKLS
TLQRYARALDARLRLVLEVPTLREVPTWHRLSSYRGSARDHQVRVGADKEILMQTNWARHISVRQVEVA
Download Length: 450 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|