Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 863478..864148 | Replicon | chromosome |
Accession | NZ_CP115447 | ||
Organism | Mycobacterium tuberculosis strain BLR 9248 2019 |
Toxin (Protein)
Gene name | higB | Uniprot ID | O53332 |
Locus tag | PAK35_RS03955 | Protein ID | WP_003899954.1 |
Coordinates | 863804..864148 (-) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | G0THF6 |
Locus tag | PAK35_RS03950 | Protein ID | WP_003899955.1 |
Coordinates | 863478..863807 (-) | Length | 110 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PAK35_RS03925 (PAK35_03925) | 858893..859927 | + | 1035 | WP_003416786.1 | IS30 family transposase | - |
PAK35_RS03930 (PAK35_03930) | 860174..860383 | - | 210 | WP_003416778.1 | hypothetical protein | - |
PAK35_RS03935 (PAK35_03935) | 860551..861816 | + | 1266 | WP_003902423.1 | hypothetical protein | - |
PAK35_RS03940 (PAK35_03940) | 861976..862596 | - | 621 | WP_003899957.1 | RES family NAD+ phosphorylase | - |
PAK35_RS03945 (PAK35_03945) | 862593..862940 | - | 348 | WP_003899956.1 | DUF2384 domain-containing protein | - |
PAK35_RS03950 (PAK35_03950) | 863478..863807 | - | 330 | WP_003899955.1 | XRE family transcriptional regulator | Antitoxin |
PAK35_RS03955 (PAK35_03955) | 863804..864148 | - | 345 | WP_003899954.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
PAK35_RS03960 (PAK35_03960) | 864379..864831 | + | 453 | WP_003899953.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
PAK35_RS03965 (PAK35_03965) | 864834..865268 | + | 435 | WP_003899952.1 | type II toxin-antitoxin system VapC family toxin | - |
PAK35_RS03970 (PAK35_03970) | 865377..866638 | + | 1262 | WP_087902221.1 | IS3-like element IS987 family transposase | - |
PAK35_RS03975 (PAK35_03975) | 866973..868262 | - | 1290 | WP_003416640.1 | ATP-binding protein | - |
PAK35_RS03980 (PAK35_03980) | 868550..868843 | - | 294 | WP_003416635.1 | hypothetical protein | - |
PAK35_RS03985 (PAK35_03985) | 868856..869067 | - | 212 | Protein_790 | (R)-hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 12692.50 Da Isoelectric Point: 5.6920
>T267098 WP_003899954.1 NZ_CP115447:c864148-863804 [Mycobacterium tuberculosis]
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
MAVILLPQVERWFFALNRDAMASVTGAIDLLEMEGPTLGRPVVDKVNDSTFHNMKELRPAGTSIRILFAFDPARQAILLL
GGDKAGNWKRWYDNNIPIADQRSENWLASEHGGG
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U4FBK2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | G0THF6 |