Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 11447..12147 | Replicon | chromosome |
| Accession | NZ_CP115188 | ||
| Organism | Vibrio furnissii strain MT14 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | - |
| Locus tag | O8413_RS00045 | Protein ID | WP_237309414.1 |
| Coordinates | 11447..11857 (-) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | - |
| Locus tag | O8413_RS00050 | Protein ID | WP_237309413.1 |
| Coordinates | 11854..12147 (-) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O8413_RS00035 (O8413_00035) | 7085..10123 | + | 3039 | WP_237309417.1 | site-specific integrase | - |
| O8413_RS00040 (O8413_00040) | 10144..11388 | + | 1245 | WP_283512789.1 | hypothetical protein | - |
| O8413_RS00045 (O8413_00045) | 11447..11857 | - | 411 | WP_237309414.1 | type II toxin-antitoxin system YafO family toxin | Toxin |
| O8413_RS00050 (O8413_00050) | 11854..12147 | - | 294 | WP_237309413.1 | hypothetical protein | Antitoxin |
| O8413_RS00055 (O8413_00055) | 12421..13020 | - | 600 | WP_237309412.1 | hypothetical protein | - |
| O8413_RS00060 (O8413_00060) | 13017..14180 | - | 1164 | WP_237309411.1 | DUF3596 domain-containing protein | - |
| O8413_RS00065 (O8413_00065) | 15120..16286 | + | 1167 | WP_283512790.1 | nucleotide sugar dehydrogenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15820.00 Da Isoelectric Point: 6.7631
>T267079 WP_237309414.1 NZ_CP115188:c11857-11447 [Vibrio furnissii]
VRTSLDIRVFKHKILIDALTESELHSLTKDFRCYKETGEKPDFFGRDEAYDHPNTLPILKSEEVKHIHLAANDAPFLSSI
QFYQTSDKHLVYCQGWNEPNCFLLIAILAPDAHEQARNRTIMHNLGLIAEKFRQHF
VRTSLDIRVFKHKILIDALTESELHSLTKDFRCYKETGEKPDFFGRDEAYDHPNTLPILKSEEVKHIHLAANDAPFLSSI
QFYQTSDKHLVYCQGWNEPNCFLLIAILAPDAHEQARNRTIMHNLGLIAEKFRQHF
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|