Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | prlF-yhaV (relBE)/YhaV-PrlF |
| Location | 1404454..1405229 | Replicon | chromosome |
| Accession | NZ_CP115182 | ||
| Organism | Diaphorobacter sp. ED-3 | ||
Toxin (Protein)
| Gene name | yhaV | Uniprot ID | A0A7T1GPJ5 |
| Locus tag | PCQ86_RS06805 | Protein ID | WP_011804662.1 |
| Coordinates | 1404771..1405229 (+) | Length | 153 a.a. |
Antitoxin (Protein)
| Gene name | prlF | Uniprot ID | A0A7T1DU90 |
| Locus tag | PCQ86_RS06800 | Protein ID | WP_038204260.1 |
| Coordinates | 1404454..1404771 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| PCQ86_RS06790 | 1400781..1401875 | + | 1095 | WP_009518528.1 | signal peptidase II | - |
| PCQ86_RS06795 | 1402272..1404155 | - | 1884 | WP_009518527.1 | MobH family relaxase | - |
| PCQ86_RS06800 | 1404454..1404771 | + | 318 | WP_038204260.1 | type II toxin-antitoxin system PrlF family antitoxin | Antitoxin |
| PCQ86_RS06805 | 1404771..1405229 | + | 459 | WP_011804662.1 | type II toxin-antitoxin system YhaV family toxin | Toxin |
| PCQ86_RS06810 | 1405256..1405633 | + | 378 | WP_011804663.1 | DUF3742 family protein | - |
| PCQ86_RS06815 | 1405649..1407166 | - | 1518 | WP_011804664.1 | conjugal transfer protein TraG N-terminal domain-containing protein | - |
| PCQ86_RS06820 | 1407181..1407540 | - | 360 | WP_009518522.1 | hypothetical protein | - |
| PCQ86_RS06825 | 1407537..1408931 | - | 1395 | WP_009518521.1 | integrating conjugative element protein | - |
| PCQ86_RS06830 | 1408941..1409888 | - | 948 | WP_121382470.1 | TIGR03756 family integrating conjugative element protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1382748..1424500 | 41752 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 153 a.a. Molecular weight: 17681.07 Da Isoelectric Point: 10.3103
>T267069 WP_011804662.1 NZ_CP115182:1404771-1405229 [Diaphorobacter sp. ED-3]
MQRHGWTLLFHDCVIEPLQKLQAAARRAQENDPKGFESNANVKLFRALSQLMLEVVPGDPARDEYRQGNTLGSAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
MQRHGWTLLFHDCVIEPLQKLQAAARRAQENDPKGFESNANVKLFRALSQLMLEVVPGDPARDEYRQGNTLGSAHRHWRR
AKIGRRFRLFFRYDSKAKVIVYAWVNDEQTLRSSGSKSDPYVVFEKMLGRGNPPDDWHALIQASKQDWSKLE
Download Length: 459 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7T1GPJ5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7T1DU90 |