Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4280213..4280907 | Replicon | chromosome |
Accession | NZ_CP114896 | ||
Organism | Escherichia coli strain CM93 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | O6117_RS20880 | Protein ID | WP_001263489.1 |
Coordinates | 4280509..4280907 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | O6117_RS20875 | Protein ID | WP_000554758.1 |
Coordinates | 4280213..4280506 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6117_RS20855 (4275845) | 4275845..4276342 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
O6117_RS20860 (4276566) | 4276566..4278278 | - | 1713 | Protein_4052 | flagellar biosynthesis protein FlhA | - |
O6117_RS20865 (4278250) | 4278250..4279035 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
O6117_RS20870 (4279106) | 4279106..4280161 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
O6117_RS20875 (4280213) | 4280213..4280506 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
O6117_RS20880 (4280509) | 4280509..4280907 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
O6117_RS20885 (4280917) | 4280917..4281369 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
O6117_RS20890 (4281687) | 4281687..4281893 | + | 207 | Protein_4058 | RtcB family protein | - |
O6117_RS20895 (4281889) | 4281889..4282410 | + | 522 | Protein_4059 | peptide chain release factor H | - |
O6117_RS20900 (4282467) | 4282467..4283924 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
O6117_RS20905 (4284185) | 4284185..4284643 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (4285239) | 4285239..4285319 | + | 81 | NuclAT_12 | - | - |
- (4285239) | 4285239..4285319 | + | 81 | NuclAT_12 | - | - |
- (4285239) | 4285239..4285319 | + | 81 | NuclAT_12 | - | - |
- (4285239) | 4285239..4285319 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T267039 WP_001263489.1 NZ_CP114896:4280509-4280907 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |