Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 2630245..2630938 | Replicon | chromosome |
Accession | NZ_CP114896 | ||
Organism | Escherichia coli strain CM93 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | O6117_RS12905 | Protein ID | WP_000415584.1 |
Coordinates | 2630642..2630938 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | O6117_RS12900 | Protein ID | WP_000650107.1 |
Coordinates | 2630245..2630640 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6117_RS12890 (2626109) | 2626109..2628367 | - | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
O6117_RS12895 (2628505) | 2628505..2630112 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
O6117_RS12900 (2630245) | 2630245..2630640 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
O6117_RS12905 (2630642) | 2630642..2630938 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
O6117_RS12910 (2631143) | 2631143..2631625 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
O6117_RS12915 (2631678) | 2631678..2632070 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
O6117_RS12920 (2632222) | 2632222..2632881 | + | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
O6117_RS12925 (2632878) | 2632878..2634227 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
O6117_RS12930 (2634273) | 2634273..2634605 | - | 333 | WP_000917684.1 | DUF2645 family protein | - |
O6117_RS12935 (2634924) | 2634924..2635505 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
O6117_RS12940 (2635536) | 2635536..2635850 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T267032 WP_000415584.1 NZ_CP114896:c2630938-2630642 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT267032 WP_000650107.1 NZ_CP114896:c2630640-2630245 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|