Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-SprF3/- |
Location | 2068598..2068897 | Replicon | chromosome |
Accession | NC_017347 | ||
Organism | Staphylococcus aureus subsp. aureus T0131 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A4U0AGH1 |
Locus tag | SAT0131_RS15450 | Protein ID | WP_072482930.1 |
Coordinates | 2068721..2068897 (-) | Length | 59 a.a. |
Antitoxin (RNA)
Gene name | SprF3 | ||
Locus tag | - | ||
Coordinates | 2068598..2068653 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SAT0131_RS10350 | 2064155..2064334 | + | 180 | WP_000669789.1 | hypothetical protein | - |
SAT0131_RS10360 | 2064645..2064905 | + | 261 | WP_001791826.1 | hypothetical protein | - |
SAT0131_RS10365 | 2064958..2065308 | - | 351 | WP_000702262.1 | complement inhibitor SCIN-A | - |
SAT0131_RS15810 | 2065818..2066153 | - | 336 | Protein_1970 | SH3 domain-containing protein | - |
SAT0131_RS10375 | 2066806..2067297 | - | 492 | WP_000920041.1 | staphylokinase | - |
SAT0131_RS10380 | 2067488..2068243 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
SAT0131_RS10385 | 2068255..2068509 | - | 255 | WP_000611512.1 | phage holin | - |
SAT0131_RS10390 | 2068561..2068668 | + | 108 | Protein_1974 | hypothetical protein | - |
- | 2068590..2068729 | + | 140 | NuclAT_0 | - | - |
- | 2068590..2068729 | + | 140 | NuclAT_0 | - | - |
- | 2068590..2068729 | + | 140 | NuclAT_0 | - | - |
- | 2068590..2068729 | + | 140 | NuclAT_0 | - | - |
- | 2068598..2068653 | + | 56 | - | - | Antitoxin |
SAT0131_RS15450 | 2068721..2068897 | - | 177 | WP_072482930.1 | putative holin-like toxin | Toxin |
SAT0131_RS10400 | 2069006..2069779 | - | 774 | WP_000750412.1 | staphylococcal enterotoxin type A | - |
SAT0131_RS10405 | 2070152..2070526 | - | 375 | WP_000340977.1 | hypothetical protein | - |
SAT0131_RS10410 | 2070582..2070869 | - | 288 | WP_001262621.1 | hypothetical protein | - |
SAT0131_RS10415 | 2070915..2071067 | - | 153 | WP_001000058.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | scn / sak / sea / hlb / groEL | 2064958..2136159 | 71201 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6883.46 Da Isoelectric Point: 10.6777
>T26702 WP_072482930.1 NC_017347:c2068897-2068721 [Staphylococcus aureus subsp. aureus T0131]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIAFIGLVIKLIELSNKK
Download Length: 177 bp
>T26702 NC_017347:c2068897-2068721 [Staphylococcus aureus subsp. aureus T0131]
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
TTGGATAGATGGTGGCTATCTGAGTATAAGGAGGTGGTGCCTATGGTGGCATTACTGAAATCTTTAGAAAGGAGACGCCT
AATGATTACAATTAGTACCATGTTGCAGTTTGGTTTATTCCTTATTGCATTCATAGGTCTAGTAATCAAGCTTATTGAAT
TAAGCAATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT26702 NC_017347:2068598-2068653 [Staphylococcus aureus subsp. aureus T0131]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|