Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
| Location | 892030..892724 | Replicon | chromosome |
| Accession | NZ_CP114895 | ||
| Organism | Escherichia coli strain CM56 | ||
Toxin (Protein)
| Gene name | yafO | Uniprot ID | Q47157 |
| Locus tag | O6106_RS04285 | Protein ID | WP_001263489.1 |
| Coordinates | 892326..892724 (+) | Length | 133 a.a. |
Antitoxin (Protein)
| Gene name | yafN | Uniprot ID | S1QAE3 |
| Locus tag | O6106_RS04280 | Protein ID | WP_000554758.1 |
| Coordinates | 892030..892323 (+) | Length | 98 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6106_RS04260 (887662) | 887662..888159 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
| O6106_RS04265 (888383) | 888383..890095 | - | 1713 | Protein_810 | flagellar biosynthesis protein FlhA | - |
| O6106_RS04270 (890067) | 890067..890852 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
| O6106_RS04275 (890923) | 890923..891978 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
| O6106_RS04280 (892030) | 892030..892323 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
| O6106_RS04285 (892326) | 892326..892724 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
| O6106_RS04290 (892734) | 892734..893186 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
| O6106_RS04295 (893504) | 893504..893710 | + | 207 | Protein_816 | RtcB family protein | - |
| O6106_RS04300 (893706) | 893706..894227 | + | 522 | Protein_817 | peptide chain release factor H | - |
| O6106_RS04305 (894284) | 894284..895741 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
| O6106_RS04310 (896002) | 896002..896460 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
| - (897056) | 897056..897136 | + | 81 | NuclAT_12 | - | - |
| - (897056) | 897056..897136 | + | 81 | NuclAT_12 | - | - |
| - (897056) | 897056..897136 | + | 81 | NuclAT_12 | - | - |
| - (897056) | 897056..897136 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T266994 WP_001263489.1 NZ_CP114895:892326-892724 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A090J8B1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1QAE3 |