Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4181534..4182228 | Replicon | chromosome |
Accession | NZ_CP114894 | ||
Organism | Escherichia coli strain CM19 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | O6X69_RS20430 | Protein ID | WP_001263489.1 |
Coordinates | 4181830..4182228 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | O6X69_RS20425 | Protein ID | WP_000554758.1 |
Coordinates | 4181534..4181827 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6X69_RS20405 (4177166) | 4177166..4177663 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
O6X69_RS20410 (4177887) | 4177887..4179599 | - | 1713 | Protein_3962 | flagellar biosynthesis protein FlhA | - |
O6X69_RS20415 (4179571) | 4179571..4180356 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
O6X69_RS20420 (4180427) | 4180427..4181482 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
O6X69_RS20425 (4181534) | 4181534..4181827 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
O6X69_RS20430 (4181830) | 4181830..4182228 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
O6X69_RS20435 (4182238) | 4182238..4182690 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
O6X69_RS20440 (4183008) | 4183008..4183214 | + | 207 | Protein_3968 | RtcB family protein | - |
O6X69_RS20445 (4183210) | 4183210..4183731 | + | 522 | Protein_3969 | peptide chain release factor H | - |
O6X69_RS20450 (4183788) | 4183788..4185245 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
O6X69_RS20455 (4185506) | 4185506..4185964 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (4186560) | 4186560..4186640 | + | 81 | NuclAT_12 | - | - |
- (4186560) | 4186560..4186640 | + | 81 | NuclAT_12 | - | - |
- (4186560) | 4186560..4186640 | + | 81 | NuclAT_12 | - | - |
- (4186560) | 4186560..4186640 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T266987 WP_001263489.1 NZ_CP114894:4181830-4182228 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |