Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 2596670..2597397 | Replicon | chromosome |
Accession | NZ_CP114894 | ||
Organism | Escherichia coli strain CM19 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | O6X69_RS12760 | Protein ID | WP_000550189.1 |
Coordinates | 2597083..2597397 (-) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | O6X69_RS12755 | Protein ID | WP_000560266.1 |
Coordinates | 2596670..2597086 (-) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6X69_RS12745 (2591830) | 2591830..2594181 | + | 2352 | WP_000695487.1 | alpha-glucosidase | - |
O6X69_RS12750 (2594607) | 2594607..2596625 | + | 2019 | WP_000121433.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
O6X69_RS12755 (2596670) | 2596670..2597086 | - | 417 | WP_000560266.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
O6X69_RS12760 (2597083) | 2597083..2597397 | - | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
O6X69_RS12765 (2597681) | 2597681..2598817 | - | 1137 | WP_000018695.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
O6X69_RS12770 (2598902) | 2598902..2599405 | + | 504 | WP_001333820.1 | M48 family metallopeptidase | - |
O6X69_RS12775 (2599482) | 2599482..2600174 | + | 693 | WP_000942548.1 | vancomycin high temperature exclusion protein | - |
O6X69_RS12780 (2600253) | 2600253..2601239 | + | 987 | WP_000617698.1 | Gfo/Idh/MocA family oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T266981 WP_000550189.1 NZ_CP114894:c2597397-2597083 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 14995.42 Da Isoelectric Point: 4.4547
>AT266981 WP_000560266.1 NZ_CP114894:c2597086-2596670 [Escherichia coli]
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|