Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 1936297..1936990 | Replicon | chromosome |
Accession | NZ_CP114893 | ||
Organism | Escherichia coli strain CM13 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | O6R07_RS09470 | Protein ID | WP_000415584.1 |
Coordinates | 1936297..1936593 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | O6R07_RS09475 | Protein ID | WP_000650107.1 |
Coordinates | 1936595..1936990 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6R07_RS09435 (1931385) | 1931385..1931699 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
O6R07_RS09440 (1931730) | 1931730..1932311 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
O6R07_RS09445 (1932630) | 1932630..1932962 | + | 333 | WP_000917684.1 | DUF2645 family protein | - |
O6R07_RS09450 (1933008) | 1933008..1934357 | - | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
O6R07_RS09455 (1934354) | 1934354..1935013 | - | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
O6R07_RS09460 (1935165) | 1935165..1935557 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
O6R07_RS09465 (1935610) | 1935610..1936092 | + | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
O6R07_RS09470 (1936297) | 1936297..1936593 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
O6R07_RS09475 (1936595) | 1936595..1936990 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
O6R07_RS09480 (1937123) | 1937123..1938730 | + | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
O6R07_RS09485 (1938868) | 1938868..1941126 | + | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T266950 WP_000415584.1 NZ_CP114893:1936297-1936593 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT266950 WP_000650107.1 NZ_CP114893:1936595-1936990 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|