Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 286345..287039 | Replicon | chromosome |
Accession | NZ_CP114893 | ||
Organism | Escherichia coli strain CM13 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | O6R07_RS01495 | Protein ID | WP_001263489.1 |
Coordinates | 286345..286743 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | O6R07_RS01500 | Protein ID | WP_000554758.1 |
Coordinates | 286746..287039 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (281933) | 281933..282013 | - | 81 | NuclAT_12 | - | - |
- (281933) | 281933..282013 | - | 81 | NuclAT_12 | - | - |
- (281933) | 281933..282013 | - | 81 | NuclAT_12 | - | - |
- (281933) | 281933..282013 | - | 81 | NuclAT_12 | - | - |
O6R07_RS01470 (282609) | 282609..283067 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
O6R07_RS01475 (283328) | 283328..284785 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
O6R07_RS01480 (284842) | 284842..285363 | - | 522 | Protein_292 | peptide chain release factor H | - |
O6R07_RS01485 (285359) | 285359..285565 | - | 207 | Protein_293 | RtcB family protein | - |
O6R07_RS01490 (285883) | 285883..286335 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
O6R07_RS01495 (286345) | 286345..286743 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
O6R07_RS01500 (286746) | 286746..287039 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
O6R07_RS01505 (287091) | 287091..288146 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
O6R07_RS01510 (288217) | 288217..289002 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
O6R07_RS01515 (288974) | 288974..290686 | + | 1713 | Protein_299 | flagellar biosynthesis protein FlhA | - |
O6R07_RS01520 (290910) | 290910..291407 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T266943 WP_001263489.1 NZ_CP114893:c286743-286345 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |