Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 4047805..4048499 | Replicon | chromosome |
Accession | NZ_CP114892 | ||
Organism | Escherichia coli strain CM5 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | O6Q95_RS19770 | Protein ID | WP_001263489.1 |
Coordinates | 4048101..4048499 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | O6Q95_RS19765 | Protein ID | WP_000554758.1 |
Coordinates | 4047805..4048098 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6Q95_RS19745 (4043437) | 4043437..4043934 | + | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
O6Q95_RS19750 (4044158) | 4044158..4045870 | - | 1713 | Protein_3845 | flagellar biosynthesis protein FlhA | - |
O6Q95_RS19755 (4045842) | 4045842..4046627 | + | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
O6Q95_RS19760 (4046698) | 4046698..4047753 | + | 1056 | WP_001226164.1 | DNA polymerase IV | - |
O6Q95_RS19765 (4047805) | 4047805..4048098 | + | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
O6Q95_RS19770 (4048101) | 4048101..4048499 | + | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
O6Q95_RS19775 (4048509) | 4048509..4048961 | + | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
O6Q95_RS19780 (4049279) | 4049279..4049485 | + | 207 | Protein_3851 | RtcB family protein | - |
O6Q95_RS19785 (4049481) | 4049481..4050002 | + | 522 | Protein_3852 | peptide chain release factor H | - |
O6Q95_RS19790 (4050059) | 4050059..4051516 | - | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
O6Q95_RS19795 (4051777) | 4051777..4052235 | + | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
- (4052831) | 4052831..4052911 | + | 81 | NuclAT_12 | - | - |
- (4052831) | 4052831..4052911 | + | 81 | NuclAT_12 | - | - |
- (4052831) | 4052831..4052911 | + | 81 | NuclAT_12 | - | - |
- (4052831) | 4052831..4052911 | + | 81 | NuclAT_12 | - | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T266938 WP_001263489.1 NZ_CP114892:4048101-4048499 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |