Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 2397839..2398532 | Replicon | chromosome |
Accession | NZ_CP114892 | ||
Organism | Escherichia coli strain CM5 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | O6Q95_RS11795 | Protein ID | WP_000415584.1 |
Coordinates | 2398236..2398532 (-) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | O6Q95_RS11790 | Protein ID | WP_000650107.1 |
Coordinates | 2397839..2398234 (-) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O6Q95_RS11780 (2393703) | 2393703..2395961 | - | 2259 | WP_001281881.1 | DNA topoisomerase IV subunit A | - |
O6Q95_RS11785 (2396099) | 2396099..2397706 | - | 1608 | WP_001295629.1 | ABC transporter substrate-binding protein | - |
O6Q95_RS11790 (2397839) | 2397839..2398234 | - | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
O6Q95_RS11795 (2398236) | 2398236..2398532 | - | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
O6Q95_RS11800 (2398737) | 2398737..2399219 | - | 483 | WP_000183505.1 | GyrI-like domain-containing protein | - |
O6Q95_RS11805 (2399272) | 2399272..2399664 | - | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
O6Q95_RS11810 (2399816) | 2399816..2400475 | + | 660 | WP_001221495.1 | quorum sensing response regulator transcription factor QseB | - |
O6Q95_RS11815 (2400472) | 2400472..2401821 | + | 1350 | WP_000673402.1 | quorum sensing histidine kinase QseC | - |
O6Q95_RS11820 (2401867) | 2401867..2402199 | - | 333 | WP_000917684.1 | DUF2645 family protein | - |
O6Q95_RS11825 (2402518) | 2402518..2403099 | + | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
O6Q95_RS11830 (2403130) | 2403130..2403444 | + | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T266931 WP_000415584.1 NZ_CP114892:c2398532-2398236 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT266931 WP_000650107.1 NZ_CP114892:c2398234-2397839 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|