Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 3119960..3120654 | Replicon | chromosome |
Accession | NZ_CP114891 | ||
Organism | Escherichia coli strain CM2 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | Q47157 |
Locus tag | O6Q44_RS15440 | Protein ID | WP_001263489.1 |
Coordinates | 3119960..3120358 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1QAE3 |
Locus tag | O6Q44_RS15445 | Protein ID | WP_000554758.1 |
Coordinates | 3120361..3120654 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (3115548) | 3115548..3115628 | - | 81 | NuclAT_12 | - | - |
- (3115548) | 3115548..3115628 | - | 81 | NuclAT_12 | - | - |
- (3115548) | 3115548..3115628 | - | 81 | NuclAT_12 | - | - |
- (3115548) | 3115548..3115628 | - | 81 | NuclAT_12 | - | - |
O6Q44_RS15415 (3116224) | 3116224..3116682 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
O6Q44_RS15420 (3116943) | 3116943..3118400 | + | 1458 | WP_001292994.1 | cytosol nonspecific dipeptidase | - |
O6Q44_RS15425 (3118457) | 3118457..3118978 | - | 522 | Protein_3013 | peptide chain release factor H | - |
O6Q44_RS15430 (3118974) | 3118974..3119180 | - | 207 | Protein_3014 | RtcB family protein | - |
O6Q44_RS15435 (3119498) | 3119498..3119950 | - | 453 | WP_001059892.1 | GNAT family N-acetyltransferase | - |
O6Q44_RS15440 (3119960) | 3119960..3120358 | - | 399 | WP_001263489.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
O6Q44_RS15445 (3120361) | 3120361..3120654 | - | 294 | WP_000554758.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
O6Q44_RS15450 (3120706) | 3120706..3121761 | - | 1056 | WP_001226164.1 | DNA polymerase IV | - |
O6Q44_RS15455 (3121832) | 3121832..3122617 | - | 786 | WP_000207552.1 | putative lateral flagellar export/assembly protein LafU | - |
O6Q44_RS15460 (3122589) | 3122589..3124301 | + | 1713 | Protein_3020 | flagellar biosynthesis protein FlhA | - |
O6Q44_RS15465 (3124525) | 3124525..3125022 | - | 498 | WP_000006255.1 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15487.84 Da Isoelectric Point: 7.4215
>T266910 WP_001263489.1 NZ_CP114891:c3120358-3119960 [Escherichia coli]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANENNPFPPQLRQFSRT
NDEAHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A090J8B1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S1QAE3 |