Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprG-sprF/- |
| Location | 2129322..2129538 | Replicon | chromosome |
| Accession | NC_017343 | ||
| Organism | Staphylococcus aureus subsp. aureus ECT-R 2 | ||
Toxin (Protein)
| Gene name | SprG3 | Uniprot ID | Q2FWA7 |
| Locus tag | ECTR2_RS10680 | Protein ID | WP_001802298.1 |
| Coordinates | 2129434..2129538 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | SprF1 | ||
| Locus tag | - | ||
| Coordinates | 2129322..2129377 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTR2_RS10660 | 2125528..2126193 | - | 666 | WP_001024095.1 | SDR family oxidoreductase | - |
| ECTR2_RS10665 | 2126345..2126665 | + | 321 | WP_000003759.1 | Zn(II)-responsive metalloregulatory transcriptional repressor CzrA | - |
| ECTR2_RS10670 | 2126667..2127644 | + | 978 | WP_000019734.1 | CDF family zinc efflux transporter CzrB | - |
| ECTR2_RS10675 | 2127910..2129001 | + | 1092 | WP_000495669.1 | hypothetical protein | - |
| - | 2129322..2129377 | + | 56 | - | - | Antitoxin |
| ECTR2_RS10680 | 2129434..2129538 | - | 105 | WP_001802298.1 | hypothetical protein | Toxin |
| ECTR2_RS14370 | 2130218..2130376 | + | 159 | WP_001792784.1 | hypothetical protein | - |
| ECTR2_RS10685 | 2131034..2131891 | - | 858 | WP_000370923.1 | Cof-type HAD-IIB family hydrolase | - |
| ECTR2_RS10690 | 2131959..2132741 | - | 783 | WP_000908182.1 | ABC transporter ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3906.77 Da Isoelectric Point: 5.5724
>T26691 WP_001802298.1 NC_017343:c2129538-2129434 [Staphylococcus aureus subsp. aureus ECT-R 2]
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
MLLLERTSMSDFEMLMVVLTIIGLVLISTQDHKK
Download Length: 105 bp
>T26691 NC_017343:c2129538-2129434 [Staphylococcus aureus subsp. aureus ECT-R 2]
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
TTGTTACTCCTAGAAAGGACTAGCATGTCTGATTTTGAAATGCTGATGGTTGTATTAACAATCATTGGTTTAGTATTGAT
TAGTACTCAAGACCATAAAAAATAA
Antitoxin
Download Length: 56 bp
>AT26691 NC_017343:2129322-2129377 [Staphylococcus aureus subsp. aureus ECT-R 2]
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACACTCGGAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|