Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 5135353..5135968 | Replicon | chromosome |
Accession | NZ_CP114886 | ||
Organism | Endozoicomonas sp. GU-1 strain Ap1-3 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | O2T12_RS21475 | Protein ID | WP_269675606.1 |
Coordinates | 5135642..5135968 (-) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | O2T12_RS21470 | Protein ID | WP_269675605.1 |
Coordinates | 5135353..5135655 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O2T12_RS21460 (O2T12_21460) | 5130918..5133581 | + | 2664 | WP_269675603.1 | hypothetical protein | - |
O2T12_RS21465 (O2T12_21465) | 5133995..5135284 | + | 1290 | WP_269675604.1 | outer membrane protein transport protein | - |
O2T12_RS21470 (O2T12_21470) | 5135353..5135655 | - | 303 | WP_269675605.1 | NadS family protein | Antitoxin |
O2T12_RS21475 (O2T12_21475) | 5135642..5135968 | - | 327 | WP_269675606.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O2T12_RS21480 (O2T12_21480) | 5136143..5136973 | - | 831 | WP_269675964.1 | amino acid ABC transporter ATP-binding protein | - |
O2T12_RS21485 (O2T12_21485) | 5136996..5138086 | - | 1091 | Protein_4193 | amino acid ABC transporter permease | - |
O2T12_RS21490 (O2T12_21490) | 5138098..5139214 | - | 1117 | Protein_4194 | amino acid ABC transporter permease | - |
O2T12_RS21495 (O2T12_21495) | 5139440..5140465 | - | 1026 | WP_269675608.1 | amino acid ABC transporter substrate-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 12640.49 Da Isoelectric Point: 8.8134
>T266885 WP_269675606.1 NZ_CP114886:c5135968-5135642 [Endozoicomonas sp. GU-1]
MEFVEASIFTKIITQLMSDDDYRAMQEAMIAQPDIGSVIRGTGGLRKFRWKLGDSGKRGGVRTIYYWQVHEETFYMLYAY
TKNRQKDLTSVEKKVLSELAREFCNERP
MEFVEASIFTKIITQLMSDDDYRAMQEAMIAQPDIGSVIRGTGGLRKFRWKLGDSGKRGGVRTIYYWQVHEETFYMLYAY
TKNRQKDLTSVEKKVLSELAREFCNERP
Download Length: 327 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|