Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/RelE-HTH |
Location | 2451480..2452169 | Replicon | chromosome |
Accession | NZ_CP114853 | ||
Organism | Klebsiella pneumoniae strain S245 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A331C6E2 |
Locus tag | O5O52_RS12135 | Protein ID | WP_021469727.1 |
Coordinates | 2451480..2451797 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A6B0N7G3 |
Locus tag | O5O52_RS12140 | Protein ID | WP_020804705.1 |
Coordinates | 2451873..2452169 (+) | Length | 99 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O5O52_RS12105 (2447182) | 2447182..2447691 | + | 510 | WP_020802144.1 | GNAT family N-acetyltransferase | - |
O5O52_RS12110 (2447701) | 2447701..2448627 | + | 927 | WP_032435210.1 | amino acid ABC transporter permease | - |
O5O52_RS12115 (2448611) | 2448611..2449390 | + | 780 | WP_002906697.1 | amino acid ABC transporter ATP-binding protein | - |
O5O52_RS12120 (2449429) | 2449429..2450280 | + | 852 | WP_072198177.1 | transporter substrate-binding domain-containing protein | - |
O5O52_RS12125 (2450358) | 2450358..2450975 | + | 618 | WP_032425015.1 | glutathione S-transferase family protein | - |
O5O52_RS12130 (2451046) | 2451046..2451273 | + | 228 | WP_002906690.1 | tautomerase PptA | - |
O5O52_RS12135 (2451480) | 2451480..2451797 | + | 318 | WP_021469727.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O5O52_RS12140 (2451873) | 2451873..2452169 | + | 297 | WP_020804705.1 | NadS family protein | Antitoxin |
O5O52_RS12145 (2452248) | 2452248..2452694 | + | 447 | WP_032435212.1 | hypothetical protein | - |
O5O52_RS12150 (2452735) | 2452735..2454351 | - | 1617 | WP_004175961.1 | carbohydrate porin | - |
O5O52_RS12155 (2454395) | 2454395..2455777 | - | 1383 | WP_004151222.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12221.10 Da Isoelectric Point: 10.2217
>T266863 WP_021469727.1 NZ_CP114853:2451480-2451797 [Klebsiella pneumoniae]
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
MLTFIELQGFSKRRQVLLQDDEFRAFQEILINDPEAGDTISGTGGFRKIRWSRPGMGKRGGVRVIYYNVTKKGRIYLALI
YPKNEQDELNQEQKKMLRQVADLIN
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A331C6E2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A6B0N7G3 |