Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 374708..375283 | Replicon | chromosome |
Accession | NZ_CP114836 | ||
Organism | Halopseudomonas sp. MFKK-1 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | O5O48_RS01655 | Protein ID | WP_088274748.1 |
Coordinates | 374708..374986 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | graA | Uniprot ID | - |
Locus tag | O5O48_RS01660 | Protein ID | WP_088274746.1 |
Coordinates | 374999..375283 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O5O48_RS01650 | 373129..374409 | + | 1281 | WP_269687987.1 | MgtC/SapB family protein | - |
O5O48_RS01655 | 374708..374986 | + | 279 | WP_088274748.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O5O48_RS01660 | 374999..375283 | + | 285 | WP_088274746.1 | HigA family addiction module antitoxin | Antitoxin |
O5O48_RS01665 | 375419..376999 | - | 1581 | WP_269687988.1 | glutamine-hydrolyzing GMP synthase | - |
O5O48_RS01670 | 377112..378584 | - | 1473 | WP_269687989.1 | IMP dehydrogenase | - |
O5O48_RS01675 | 378763..380139 | + | 1377 | WP_269687990.1 | exodeoxyribonuclease VII large subunit | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10345.86 Da Isoelectric Point: 9.4837
>T266855 WP_088274748.1 NZ_CP114836:374708-374986 [Halopseudomonas sp. MFKK-1]
MITGFQHKGLEAFYKTGTTRGIQAAHAAKLSRILALLDVAAGPDDLNIPSFKLHQLKGELNGYWSIRVNGNWRVTFRFIG
VDVELVNYVDYH
MITGFQHKGLEAFYKTGTTRGIQAAHAAKLSRILALLDVAAGPDDLNIPSFKLHQLKGELNGYWSIRVNGNWRVTFRFIG
VDVELVNYVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|