Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) higBA (relBE)/COG4683-HTH_37
Location 15629..16286 Replicon plasmid p21OH12SH02A-1
Accession NZ_CP114802
Organism Citrobacter sp. 21OH12SH02A-Citro

Toxin (Protein)


Gene name higB Uniprot ID U3PDC3
Locus tag O6D90_RS23595 Protein ID WP_000270043.1
Coordinates 15629..15979 (+) Length 117 a.a.

Antitoxin (Protein)


Gene name higA Uniprot ID -
Locus tag O6D90_RS23600 Protein ID WP_000124640.1
Coordinates 15984..16286 (+) Length 101 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
O6D90_RS23555 (O6D90_23555) 11184..11888 + 705 WP_001067855.1 IS6-like element IS26 family transposase -
O6D90_RS23560 (O6D90_23560) 12103..12600 - 498 WP_000062185.1 hypothetical protein -
O6D90_RS23565 (O6D90_23565) 12603..13091 - 489 WP_001273096.1 DUF1643 domain-containing protein -
O6D90_RS23570 (O6D90_23570) 13188..13523 + 336 WP_000683476.1 hypothetical protein -
O6D90_RS23575 (O6D90_23575) 13538..14008 - 471 WP_001281821.1 hypothetical protein -
O6D90_RS23580 (O6D90_23580) 14001..14372 - 372 WP_000516916.1 hypothetical protein -
O6D90_RS23585 (O6D90_23585) 14383..14577 - 195 WP_000343597.1 hypothetical protein -
O6D90_RS23590 (O6D90_23590) 14918..15466 - 549 WP_001061574.1 transcriptional regulator -
O6D90_RS23595 (O6D90_23595) 15629..15979 + 351 WP_000270043.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
O6D90_RS23600 (O6D90_23600) 15984..16286 + 303 WP_000124640.1 XRE family transcriptional regulator Antitoxin
O6D90_RS23605 (O6D90_23605) 16313..16606 - 294 WP_001239997.1 chromosome segregation protein ParM -
O6D90_RS23610 (O6D90_23610) 16694..16966 - 273 WP_001043047.1 HU family DNA-binding protein -
O6D90_RS23615 (O6D90_23615) 17024..17551 - 528 WP_001236377.1 thermonuclease family protein -
O6D90_RS23620 (O6D90_23620) 17568..17756 - 189 WP_001270411.1 hypothetical protein -
O6D90_RS23625 (O6D90_23625) 17782..18639 - 858 WP_001167032.1 hypothetical protein -
O6D90_RS23630 (O6D90_23630) 18626..18856 - 231 WP_000972663.1 hypothetical protein -
O6D90_RS23635 (O6D90_23635) 18856..19374 - 519 WP_000210756.1 nitrite reductase -
O6D90_RS23640 (O6D90_23640) 19371..19817 - 447 WP_000919345.1 Fe3+-siderophore ABC transporter permease -
O6D90_RS23645 (O6D90_23645) 19817..20176 - 360 WP_000422768.1 hypothetical protein -
O6D90_RS23650 (O6D90_23650) 20233..20661 - 429 WP_000591074.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid sul1 / qacE / aadA16 / dfrA27 / ARR-3 / aac(6')-Ib-cr / aac(3)-IId / sul2 / aph(3'')-Ib / aph(6)-Id / tet(A) / floR / mph(A) - 1..163408 163408


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin HigB-like

(12-106)

Antitoxin

Cro/C1-type helix-turn-helix domain

(33-79)


Sequences

Toxin        


Download         Length: 117 a.a.        Molecular weight: 13328.21 Da        Isoelectric Point: 5.2421

>T266854 WP_000270043.1 NZ_CP114802:15629-15979 [Citrobacter sp. 21OH12SH02A-Citro]
MWVIETTDTFDEWFDALDDTDRANVLASMMVLRDRGPMLSRPYADTVNGSSYSNMKELRVQSKGDPIRAFFAFDPKRKGI
LLCAGNKTGDEKRFYEVMIPIADREFAAHLDKLKKE

Download         Length: 351 bp

Antitoxin


Download         Length: 101 a.a.        Molecular weight: 11006.73 Da        Isoelectric Point: 7.2036

>AT266854 WP_000124640.1 NZ_CP114802:15984-16286 [Citrobacter sp. 21OH12SH02A-Citro]
MARTLDQMLATEKPEVVAKAQKAATEMLLNIHLAELRDRMNLTQGEIAASLGVRQPTVSEMEKPGRDLKLSSIKRYVEAS
GGKLRLDVELPDGTHYGFAV

Download         Length: 303 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7G8AFB9

Antitoxin

Source ID Structure

References