Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 64997..65646 | Replicon | chromosome |
| Accession | NZ_CP114801 | ||
| Organism | Citrobacter sp. 21OH12SH02A-Citro | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A7L6TVT2 |
| Locus tag | O6D90_RS00325 | Protein ID | WP_016157800.1 |
| Coordinates | 64997..65338 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A7L6TWH1 |
| Locus tag | O6D90_RS00330 | Protein ID | WP_016157799.1 |
| Coordinates | 65347..65646 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O6D90_RS00310 (61433) | 61433..62761 | + | 1329 | WP_016155042.1 | MFS transporter | - |
| O6D90_RS00315 (62904) | 62904..64295 | + | 1392 | WP_003023929.1 | hexose-6-phosphate:phosphate antiporter | - |
| O6D90_RS00320 (64444) | 64444..64896 | + | 453 | WP_016157801.1 | DUF1198 family protein | - |
| O6D90_RS00325 (64997) | 64997..65338 | + | 342 | WP_016157800.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| O6D90_RS00330 (65347) | 65347..65646 | + | 300 | WP_016157799.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| O6D90_RS00335 (65765) | 65765..66949 | + | 1185 | WP_016157798.1 | purine ribonucleoside efflux pump NepI | - |
| O6D90_RS00340 (67005) | 67005..68387 | - | 1383 | WP_016157797.1 | glycoside hydrolase family 1 protein | - |
| O6D90_RS00345 (68480) | 68480..68773 | - | 294 | WP_016155038.1 | YicS family protein | - |
| O6D90_RS00350 (68904) | 68904..69320 | + | 417 | WP_016157796.1 | GNAT family N-acetyltransferase | - |
| O6D90_RS00355 (69492) | 69492..70310 | + | 819 | WP_016157795.1 | lipoprotein NlpA | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13061.92 Da Isoelectric Point: 5.6550
>T266842 WP_016157800.1 NZ_CP114801:64997-65338 [Citrobacter sp. 21OH12SH02A-Citro]
MWEVETTDVFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKELRVQHQGNPIRAFFVFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLNK
MWEVETTDVFDKWFDVQTEALKEDMLAAMMILSEYGPQLGRPFADTVNASAFSNMKELRVQHQGNPIRAFFVFDPSRHGI
VLCAGDKTGLNEKKFYKEMIRLADAEYRNHLNK
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6TVT2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7L6TWH1 |