Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 79485..80212 | Replicon | plasmid p3045-2 |
| Accession | NZ_CP114774 | ||
| Organism | Raoultella planticola strain RP_3045 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A5Q9LNL2 |
| Locus tag | O4J57_RS29025 | Protein ID | WP_004118600.1 |
| Coordinates | 79901..80212 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | V0AHC4 |
| Locus tag | O4J57_RS29020 | Protein ID | WP_000990392.1 |
| Coordinates | 79485..79904 (-) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4J57_RS28985 (O4J57_28980) | 75172..75534 | - | 363 | WP_000783215.1 | arsenite efflux transporter metallochaperone ArsD | - |
| O4J57_RS28990 (O4J57_28985) | 75582..75935 | - | 354 | WP_001114073.1 | As(III)-sensing metalloregulatory transcriptional repressor ArsR | - |
| O4J57_RS28995 (O4J57_28990) | 76228..76368 | + | 141 | WP_004118614.1 | hypothetical protein | - |
| O4J57_RS29000 (O4J57_28995) | 76536..76844 | + | 309 | WP_020324596.1 | Ref family recombination enhancement nuclease | - |
| O4J57_RS29005 (O4J57_29000) | 77268..77927 | + | 660 | WP_000078540.1 | hypothetical protein | - |
| O4J57_RS29010 (O4J57_29005) | 77924..78253 | + | 330 | WP_004118613.1 | hypothetical protein | - |
| O4J57_RS29015 (O4J57_29010) | 78246..79448 | + | 1203 | WP_003031541.1 | hypothetical protein | - |
| O4J57_RS29020 (O4J57_29015) | 79485..79904 | - | 420 | WP_000990392.1 | helix-turn-helix domain-containing protein | Antitoxin |
| O4J57_RS29025 (O4J57_29020) | 79901..80212 | - | 312 | WP_004118600.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| O4J57_RS29030 (O4J57_29025) | 80423..80803 | + | 381 | Protein_87 | gluconate permease | - |
| O4J57_RS29035 (O4J57_29030) | 80853..81548 | - | 696 | WP_004118595.1 | lactate utilization protein C | - |
| O4J57_RS29040 (O4J57_29035) | 81541..82968 | - | 1428 | WP_000023895.1 | LutB/LldF family L-lactate oxidation iron-sulfur protein | - |
| O4J57_RS29045 (O4J57_29040) | 82979..83698 | - | 720 | WP_001102107.1 | (Fe-S)-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..212569 | 212569 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12386.14 Da Isoelectric Point: 10.0935
>T266832 WP_004118600.1 NZ_CP114774:c80212-79901 [Raoultella planticola]
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
MHIVSRAPFDTATRQFPNQAAALDDVYRTLKRENYTSPDEMKKRFASLDRMKYREKWWVIDVGGGNLRVMFFADFERGKI
FIKHITTHAEYDKLTDFYRRTKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15534.71 Da Isoelectric Point: 4.4702
>AT266832 WP_000990392.1 NZ_CP114774:c79904-79485 [Raoultella planticola]
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
MMYTDAIQAANSLVSIVPLLGGNASRKDYEDALTLVEYLVEHEPDHPLVDMLVAKIAQYEDEAEEFAEFNDRIAALPSGV
ALLRVLMDQHKLTQSDFEEEIGKKSLVSRILNGTRSLTLDHMKALARRFNIPPSSFMDA
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Q9LNL2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | V0AHC4 |