Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1802744..1802924 | Replicon | chromosome |
| Accession | NC_017343 | ||
| Organism | Staphylococcus aureus subsp. aureus ECT-R 2 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | ECTR2_RS14835 | Protein ID | WP_001801861.1 |
| Coordinates | 1802744..1802839 (+) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1802867..1802924 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| ECTR2_RS08700 | 1797907..1798557 | + | 651 | WP_001795210.1 | excalibur calcium-binding domain-containing protein | - |
| ECTR2_RS08705 | 1798638..1799633 | + | 996 | WP_000070642.1 | DUF4352 domain-containing protein | - |
| ECTR2_RS08710 | 1799708..1800334 | + | 627 | WP_000669024.1 | hypothetical protein | - |
| ECTR2_RS08715 | 1800375..1800716 | + | 342 | WP_000627540.1 | DUF3969 family protein | - |
| ECTR2_RS08720 | 1800817..1801389 | + | 573 | WP_000414216.1 | hypothetical protein | - |
| ECTR2_RS14275 | 1801587..1802599 | - | 1013 | Protein_1673 | IS3 family transposase | - |
| ECTR2_RS14835 | 1802744..1802839 | + | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| - | 1802867..1802924 | - | 58 | - | - | Antitoxin |
| ECTR2_RS08740 | 1802962..1803063 | + | 102 | WP_001792025.1 | hypothetical protein | - |
| ECTR2_RS14695 | 1803041..1803202 | - | 162 | Protein_1676 | transposase | - |
| ECTR2_RS08745 | 1803193..1803687 | - | 495 | Protein_1677 | transposase | - |
| ECTR2_RS08750 | 1804139..1805368 | - | 1230 | WP_000072627.1 | restriction endonuclease subunit S | - |
| ECTR2_RS08755 | 1805361..1806917 | - | 1557 | WP_000028669.1 | type I restriction-modification system subunit M | - |
| ECTR2_RS08760 | 1807081..1807215 | - | 135 | WP_001791797.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lukD / hlgA / selk | 1797149..1848280 | 51131 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T26683 WP_001801861.1 NC_017343:1802744-1802839 [Staphylococcus aureus subsp. aureus ECT-R 2]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T26683 NC_017343:1802744-1802839 [Staphylococcus aureus subsp. aureus ECT-R 2]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT26683 NC_017343:c1802924-1802867 [Staphylococcus aureus subsp. aureus ECT-R 2]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|