Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/MqsA(antitoxin) |
| Location | 5509257..5509848 | Replicon | chromosome |
| Accession | NZ_CP114771 | ||
| Organism | Endozoicomonas sp. GU-1 strain Ap1-2 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | O3276_RS23155 | Protein ID | WP_269673417.1 |
| Coordinates | 5509537..5509848 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | O3276_RS23150 | Protein ID | WP_101746508.1 |
| Coordinates | 5509257..5509544 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3276_RS23125 (O3276_23125) | 5504964..5505803 | - | 840 | WP_269673413.1 | protein kinase | - |
| O3276_RS23130 (O3276_23130) | 5505972..5507270 | + | 1299 | WP_269673414.1 | FAD-binding oxidoreductase | - |
| O3276_RS23135 (O3276_23135) | 5507366..5507881 | - | 516 | WP_269673415.1 | hypothetical protein | - |
| O3276_RS23140 (O3276_23140) | 5508047..5508532 | + | 486 | WP_269673416.1 | hypothetical protein | - |
| O3276_RS23145 (O3276_23145) | 5508539..5509161 | - | 623 | Protein_4518 | DJ-1/PfpI family protein | - |
| O3276_RS23150 (O3276_23150) | 5509257..5509544 | - | 288 | WP_101746508.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| O3276_RS23155 (O3276_23155) | 5509537..5509848 | - | 312 | WP_269673417.1 | transcriptional regulator | Toxin |
| O3276_RS23160 (O3276_23160) | 5509954..5510295 | - | 342 | WP_269673418.1 | divalent-cation tolerance protein CutA | - |
| O3276_RS23165 (O3276_23165) | 5510393..5511451 | - | 1059 | WP_269673419.1 | methyltransferase domain-containing protein | - |
| O3276_RS23170 (O3276_23170) | 5511489..5512349 | - | 861 | WP_269673420.1 | MIP/aquaporin family protein | - |
| O3276_RS23175 (O3276_23175) | 5513315..5514694 | + | 1380 | WP_269673421.1 | DEAD/DEAH box helicase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12034.82 Da Isoelectric Point: 9.8865
>T266820 WP_269673417.1 NZ_CP114771:c5509848-5509537 [Endozoicomonas sp. GU-1]
MIFIETSRFTKLLSGYLSDDEYRVLQWHLQQKPDSGDLIRGSGGVRKIRWAPDGKGKSGSIRVIYYWKKSDFEIWMLTLY
RKSERESIPGHILKKVAEAINDE
MIFIETSRFTKLLSGYLSDDEYRVLQWHLQQKPDSGDLIRGSGGVRKIRWAPDGKGKSGSIRVIYYWKKSDFEIWMLTLY
RKSERESIPGHILKKVAEAINDE
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|