Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 5790088..5790683 | Replicon | chromosome |
Accession | NZ_CP114761 | ||
Organism | Pseudomonas aeruginosa strain NF143349 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | O4M85_RS27195 | Protein ID | WP_079752024.1 |
Coordinates | 5790405..5790683 (-) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | O4M85_RS27190 | Protein ID | WP_083556829.1 |
Coordinates | 5790088..5790393 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4M85_RS27155 (O4M85_27155) | 5785241..5786089 | + | 849 | WP_088376615.1 | 4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase | - |
O4M85_RS27165 (O4M85_27165) | 5786256..5787197 | + | 942 | WP_003099281.1 | ribose-phosphate pyrophosphokinase | - |
O4M85_RS27170 (O4M85_27170) | 5787314..5787928 | + | 615 | WP_033971050.1 | 50S ribosomal protein L25/general stress protein Ctc | - |
O4M85_RS27175 (O4M85_27175) | 5787970..5788554 | + | 585 | WP_033971054.1 | aminoacyl-tRNA hydrolase | - |
O4M85_RS27180 (O4M85_27180) | 5788595..5789695 | + | 1101 | WP_003099270.1 | redox-regulated ATPase YchF | - |
O4M85_RS27190 (O4M85_27190) | 5790088..5790393 | - | 306 | WP_083556829.1 | HigA family addiction module antitoxin | Antitoxin |
O4M85_RS27195 (O4M85_27195) | 5790405..5790683 | - | 279 | WP_079752024.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O4M85_RS27200 (O4M85_27200) | 5790736..5790962 | - | 227 | Protein_5369 | tyrosine-type recombinase/integrase | - |
O4M85_RS27205 (O4M85_27205) | 5791331..5791534 | + | 204 | WP_033971061.1 | hypothetical protein | - |
O4M85_RS27210 (O4M85_27210) | 5791950..5792465 | - | 516 | WP_033971063.1 | BRO family protein | - |
O4M85_RS27215 (O4M85_27215) | 5792772..5793422 | - | 651 | WP_033971066.1 | carbonate dehydratase | - |
O4M85_RS27220 (O4M85_27220) | 5793484..5794722 | - | 1239 | WP_088376614.1 | C69 family dipeptidase | - |
O4M85_RS27225 (O4M85_27225) | 5794921..5795373 | - | 453 | WP_088376613.1 | ribosomal protein S18-alanine N-acetyltransferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10673.26 Da Isoelectric Point: 8.5538
>T266804 WP_079752024.1 NZ_CP114761:c5790683-5790405 [Pseudomonas aeruginosa]
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAAKELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
MILTFRCDETRQLFETGLSRRWGAILTVATRKLAMLHAAKELRDLRSPPGNRLEPLQGKRAGQHSIRINDQWRVCFVWTD
AGPEEVEIVDYH
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|