Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 5057550..5058231 | Replicon | chromosome |
Accession | NZ_CP114761 | ||
Organism | Pseudomonas aeruginosa strain NF143349 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | O4M85_RS23725 | Protein ID | WP_015503432.1 |
Coordinates | 5057866..5058231 (-) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | O4M85_RS23720 | Protein ID | WP_016561576.1 |
Coordinates | 5057550..5057873 (-) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4M85_RS23685 (O4M85_23685) | 5053171..5054049 | + | 879 | WP_003109435.1 | hypothetical protein | - |
O4M85_RS23695 (O4M85_23695) | 5054561..5055427 | - | 867 | WP_023081971.1 | hypothetical protein | - |
O4M85_RS23700 (O4M85_23700) | 5055457..5055708 | - | 252 | WP_124136459.1 | hypothetical protein | - |
O4M85_RS23705 (O4M85_23705) | 5055925..5056928 | - | 1004 | Protein_4685 | tyrosine-type recombinase/integrase | - |
O4M85_RS23710 (O4M85_23710) | 5056928..5057320 | - | 393 | Protein_4686 | hypothetical protein | - |
O4M85_RS23715 (O4M85_23715) | 5057315..5057434 | + | 120 | Protein_4687 | IS5/IS1182 family transposase | - |
O4M85_RS23720 (O4M85_23720) | 5057550..5057873 | - | 324 | WP_016561576.1 | XRE family transcriptional regulator | Antitoxin |
O4M85_RS23725 (O4M85_23725) | 5057866..5058231 | - | 366 | WP_015503432.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O4M85_RS23730 (O4M85_23730) | 5058495..5058737 | - | 243 | WP_043884955.1 | hypothetical protein | - |
O4M85_RS23735 (O4M85_23735) | 5058944..5059216 | + | 273 | WP_003085667.1 | hypothetical protein | - |
O4M85_RS23740 (O4M85_23740) | 5059235..5059660 | - | 426 | WP_003163196.1 | VOC family protein | - |
O4M85_RS23745 (O4M85_23745) | 5059761..5060645 | + | 885 | WP_019725847.1 | LysR substrate-binding domain-containing protein | - |
O4M85_RS23750 (O4M85_23750) | 5060618..5061571 | - | 954 | WP_003085661.1 | LysR substrate-binding domain-containing protein | - |
O4M85_RS23755 (O4M85_23755) | 5061792..5062226 | + | 435 | WP_003158601.1 | RidA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13798.14 Da Isoelectric Point: 4.8219
>T266802 WP_015503432.1 NZ_CP114761:c5058231-5057866 [Pseudomonas aeruginosa]
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
VAWDIEYTDEFGDWWGSLSEDEQESLAVTVRLLEERGPSLGHPHSSGINGSRPGHMRELRTQHGGRPFRTLYAFDPRRSA
ILPIGGDKTGDDRWYELNVPIADRLHDEHLHQLREEGLIDG
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|