Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4776354..4776943 | Replicon | chromosome |
Accession | NZ_CP114600 | ||
Organism | Xanthomonas oryzae pv. oryzae strain LA20 |
Toxin (Protein)
Gene name | graT | Uniprot ID | G7TIR7 |
Locus tag | O5966_RS22405 | Protein ID | WP_012443754.1 |
Coordinates | 4776662..4776943 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | O5966_RS22400 | Protein ID | WP_011260746.1 |
Coordinates | 4776354..4776644 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O5966_RS22375 (O5966_22375) | 4771552..4771878 | - | 327 | WP_237384726.1 | hypothetical protein | - |
O5966_RS22380 (O5966_22380) | 4771947..4772981 | - | 1035 | WP_011407587.1 | IS630 family transposase | - |
O5966_RS22385 (O5966_22385) | 4773249..4773581 | + | 333 | WP_011260743.1 | hypothetical protein | - |
O5966_RS22390 (O5966_22390) | 4773741..4773928 | + | 188 | Protein_4277 | hypothetical protein | - |
O5966_RS22395 (O5966_22395) | 4774031..4775425 | - | 1395 | WP_075240796.1 | type III secretion system effector XopQ | - |
O5966_RS22400 (O5966_22400) | 4776354..4776644 | - | 291 | WP_011260746.1 | HigA family addiction module antitoxin | Antitoxin |
O5966_RS22405 (O5966_22405) | 4776662..4776943 | - | 282 | WP_012443754.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O5966_RS22410 (O5966_22410) | 4777038..4779296 | - | 2259 | WP_075240794.1 | exodeoxyribonuclease V subunit alpha | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11066.83 Da Isoelectric Point: 10.5318
>T266789 WP_012443754.1 NZ_CP114600:c4776943-4776662 [Xanthomonas oryzae pv. oryzae]
VIRSFIDKDAEKIWLGERSRRLPADIQLVARRKLRMLNAAAHLDDLRIPPANRLEALKGQRRGQYSIRINDQWRICFRWM
EGDVVQVEIVDYH
VIRSFIDKDAEKIWLGERSRRLPADIQLVARRKLRMLNAAAHLDDLRIPPANRLEALKGQRRGQYSIRINDQWRICFRWM
EGDVVQVEIVDYH
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|