Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 63302..63566 | Replicon | plasmid pWEC-2 |
Accession | NZ_CP114594 | ||
Organism | Escherichia coli strain WEC |
Toxin (Protein)
Gene name | pndA | Uniprot ID | A0A8H9BDR8 |
Locus tag | O3296_RS23685 | Protein ID | WP_023156060.1 |
Coordinates | 63414..63566 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | pndB | ||
Locus tag | - | ||
Coordinates | 63302..63359 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O3296_RS23670 (58415) | 58415..59626 | - | 1212 | WP_021560355.1 | DsbC family protein | - |
O3296_RS23675 (59701) | 59701..60894 | - | 1194 | WP_053285742.1 | hypothetical protein | - |
O3296_RS23680 (60910) | 60910..63123 | - | 2214 | WP_021560353.1 | type IA DNA topoisomerase | - |
- (63302) | 63302..63359 | - | 58 | NuclAT_0 | - | Antitoxin |
- (63302) | 63302..63359 | - | 58 | NuclAT_0 | - | Antitoxin |
- (63302) | 63302..63359 | - | 58 | NuclAT_0 | - | Antitoxin |
- (63302) | 63302..63359 | - | 58 | NuclAT_0 | - | Antitoxin |
O3296_RS23685 (63414) | 63414..63566 | + | 153 | WP_023156060.1 | Hok/Gef family protein | Toxin |
O3296_RS23690 (63638) | 63638..63889 | - | 252 | WP_001685192.1 | hypothetical protein | - |
O3296_RS23695 (64093) | 64093..64299 | + | 207 | WP_064550069.1 | DinQ-like type I toxin DqlB | - |
O3296_RS23700 (64405) | 64405..65358 | - | 954 | WP_143368613.1 | hypothetical protein | - |
O3296_RS23705 (65427) | 65427..67571 | - | 2145 | WP_021560351.1 | DotA/TraY family protein | - |
O3296_RS23710 (67606) | 67606..67830 | - | 225 | WP_021560350.1 | hypothetical protein | - |
O3296_RS23715 (67833) | 67833..68396 | - | 564 | WP_021560349.1 | conjugal transfer protein TraX | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..92065 | 92065 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5809.14 Da Isoelectric Point: 8.7948
>T266780 WP_023156060.1 NZ_CP114594:63414-63566 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCGFRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVICVTILCFVWMVRDSLCGFRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T266780 NZ_CP114594:63414-63566 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGATTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGATTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 58 bp
>AT266780 NZ_CP114594:c63359-63302 [Escherichia coli]
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|