Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HTH(antitoxin) |
| Location | 4580422..4581024 | Replicon | chromosome |
| Accession | NZ_CP114592 | ||
| Organism | Escherichia coli strain WEC | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | U9XIS6 |
| Locus tag | O3296_RS21975 | Protein ID | WP_000897305.1 |
| Coordinates | 4580713..4581024 (-) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | O3296_RS21970 | Protein ID | WP_000356397.1 |
| Coordinates | 4580422..4580712 (-) | Length | 97 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3296_RS21945 (4575854) | 4575854..4576489 | + | 636 | WP_000829013.1 | formate dehydrogenase cytochrome b556 subunit | - |
| O3296_RS21950 (4576486) | 4576486..4577415 | + | 930 | WP_000027708.1 | formate dehydrogenase accessory protein FdhE | - |
| O3296_RS21955 (4577928) | 4577928..4578908 | + | 981 | WP_000399648.1 | IS110-like element IS621 family transposase | - |
| O3296_RS21960 (4579138) | 4579138..4579380 | - | 243 | WP_001086388.1 | protein YiiF | - |
| O3296_RS21965 (4579599) | 4579599..4579817 | - | 219 | WP_001295676.1 | CopG family transcriptional regulator | - |
| O3296_RS21970 (4580422) | 4580422..4580712 | - | 291 | WP_000356397.1 | NadS family protein | Antitoxin |
| O3296_RS21975 (4580713) | 4580713..4581024 | - | 312 | WP_000897305.1 | hypothetical protein | Toxin |
| O3296_RS21980 (4581253) | 4581253..4582161 | + | 909 | WP_001162704.1 | alpha/beta hydrolase | - |
| O3296_RS21985 (4582225) | 4582225..4583166 | - | 942 | WP_001297068.1 | fatty acid biosynthesis protein FabY | - |
| O3296_RS21990 (4583211) | 4583211..4583648 | - | 438 | WP_000560983.1 | D-aminoacyl-tRNA deacylase | - |
| O3296_RS21995 (4583645) | 4583645..4584517 | - | 873 | WP_000920762.1 | virulence factor BrkB family protein | - |
| O3296_RS22000 (4584511) | 4584511..4585110 | - | 600 | WP_001295269.1 | glucose-1-phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 4577928..4578908 | 980 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12190.19 Da Isoelectric Point: 9.7791
>T266776 WP_000897305.1 NZ_CP114592:c4581024-4580713 [Escherichia coli]
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
MLFIETEIFTEDVQKLLTDDEFSRFQFFLALNPDYGEVIPETGGLRKVRWVSGGKGKRAGVRVIYFHQVKHYEIRLLLIY
RKGIKDDLSPQEKAMLRLLNTRW
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|