Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 1052055..1052782 | Replicon | chromosome |
| Accession | NZ_CP114592 | ||
| Organism | Escherichia coli strain WEC | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q3YYE6 |
| Locus tag | O3296_RS05085 | Protein ID | WP_000547563.1 |
| Coordinates | 1052055..1052366 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | O3296_RS05090 | Protein ID | WP_000126294.1 |
| Coordinates | 1052363..1052782 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O3296_RS05055 (1047198) | 1047198..1048907 | + | 1710 | WP_063625439.1 | formate hydrogenlyase subunit HycE | - |
| O3296_RS05060 (1048917) | 1048917..1049459 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| O3296_RS05065 (1049459) | 1049459..1050226 | + | 768 | WP_000067401.1 | formate hydrogenlyase subunit HycG | - |
| O3296_RS05070 (1050223) | 1050223..1050633 | + | 411 | WP_001291918.1 | formate hydrogenlyase assembly protein HycH | - |
| O3296_RS05075 (1050626) | 1050626..1051096 | + | 471 | WP_000132961.1 | hydrogenase maturation peptidase HycI | - |
| O3296_RS05080 (1051139) | 1051139..1051882 | + | 744 | WP_058101263.1 | hypothetical protein | - |
| O3296_RS05085 (1052055) | 1052055..1052366 | + | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| O3296_RS05090 (1052363) | 1052363..1052782 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| O3296_RS05095 (1052896) | 1052896..1054320 | - | 1425 | WP_000110365.1 | 6-phospho-beta-glucosidase AscB | - |
| O3296_RS05100 (1054329) | 1054329..1055786 | - | 1458 | WP_001107882.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| O3296_RS05105 (1056046) | 1056046..1057056 | + | 1011 | WP_001392554.1 | DNA-binding transcriptional regulator AscG | - |
| O3296_RS05110 (1057205) | 1057205..1057732 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T266761 WP_000547563.1 NZ_CP114592:1052055-1052366 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT266761 WP_000126294.1 NZ_CP114592:1052363-1052782 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|