Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 1503208..1503808 | Replicon | chromosome |
Accession | NZ_CP114590 | ||
Organism | Salinivibrio kushneri strain TGB19 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | O4546_RS07085 | Protein ID | WP_077523530.1 |
Coordinates | 1503208..1503531 (+) | Length | 108 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | O4546_RS07090 | Protein ID | WP_077523528.1 |
Coordinates | 1503524..1503808 (+) | Length | 95 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
O4546_RS07075 (O4546_07075) | 1498538..1501984 | - | 3447 | WP_269586717.1 | type I-F CRISPR-associated helicase Cas3f | - |
O4546_RS07080 (O4546_07080) | 1501981..1502952 | - | 972 | WP_269586718.1 | type I-F CRISPR-associated endonuclease Cas1f | - |
O4546_RS07085 (O4546_07085) | 1503208..1503531 | + | 324 | WP_077523530.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
O4546_RS07090 (O4546_07090) | 1503524..1503808 | + | 285 | WP_077523528.1 | helix-turn-helix transcriptional regulator | Antitoxin |
O4546_RS07095 (O4546_07095) | 1504880..1505149 | + | 270 | WP_077658679.1 | TIGR03643 family protein | - |
O4546_RS07100 (O4546_07100) | 1505475..1506653 | - | 1179 | WP_269586719.1 | amidase family protein | - |
O4546_RS07105 (O4546_07105) | 1506828..1507994 | - | 1167 | WP_269586720.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12130.28 Da Isoelectric Point: 10.2189
>T266755 WP_077523530.1 NZ_CP114590:1503208-1503531 [Salinivibrio kushneri]
MHWNIVFYRGVEESILNMPPKIQARMLKLLELIEKHGANLGPPHTESIGNGLFEIRAKAKEGIGRSLFCYLDGPNIYILH
AFVKKSQKTPKRDLALATGRMKEVKSE
MHWNIVFYRGVEESILNMPPKIQARMLKLLELIEKHGANLGPPHTESIGNGLFEIRAKAKEGIGRSLFCYLDGPNIYILH
AFVKKSQKTPKRDLALATGRMKEVKSE
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|