Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_31 |
| Location | 84383..84987 | Replicon | chromosome |
| Accession | NZ_CP114578 | ||
| Organism | Legionella pneumophila strain A194 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | A0A128WF47 |
| Locus tag | LpnA194_RS00405 | Protein ID | WP_011212715.1 |
| Coordinates | 84383..84706 (+) | Length | 108 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | LpnA194_RS00410 | Protein ID | WP_044499250.1 |
| Coordinates | 84703..84987 (+) | Length | 95 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LpnA194_RS00380 (LpnA194_00076) | 79530..80834 | + | 1305 | WP_040147085.1 | ATP-grasp domain-containing protein | - |
| LpnA194_RS00385 (LpnA194_00077) | 80855..81445 | + | 591 | WP_011945268.1 | alpha/beta hydrolase | - |
| LpnA194_RS00390 (LpnA194_00078) | 81429..82376 | + | 948 | WP_011945269.1 | DMT family transporter | - |
| LpnA194_RS00395 (LpnA194_00079) | 82476..82823 | + | 348 | Protein_78 | transposase family protein | - |
| LpnA194_RS00400 (LpnA194_00080) | 83079..84299 | + | 1221 | WP_044499247.1 | site-specific integrase | - |
| LpnA194_RS00405 (LpnA194_00081) | 84383..84706 | + | 324 | WP_011212715.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| LpnA194_RS00410 (LpnA194_00082) | 84703..84987 | + | 285 | WP_044499250.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| LpnA194_RS00415 (LpnA194_00083) | 85181..85984 | + | 804 | WP_229293969.1 | hypothetical protein | - |
| LpnA194_RS00420 (LpnA194_00084) | 86748..88160 | - | 1413 | WP_044499254.1 | hypothetical protein | - |
| LpnA194_RS00425 (LpnA194_00085) | 88191..88799 | - | 609 | WP_011945275.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 82476..82853 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 108 a.a. Molecular weight: 12144.36 Da Isoelectric Point: 9.7878
>T266739 WP_011212715.1 NZ_CP114578:84383-84706 [Legionella pneumophila]
MSWIVEFYNESVEEAILTMPPKIQARMIKLLELIETHGANLGPPHTEAMGDGLFEIRAKAQEGIGRSLYCYMKGKHIVVL
HAFVKKSAKTPKPDLQLALKRKREVEK
MSWIVEFYNESVEEAILTMPPKIQARMIKLLELIETHGANLGPPHTEAMGDGLFEIRAKAQEGIGRSLYCYMKGKHIVVL
HAFVKKSAKTPKPDLQLALKRKREVEK
Download Length: 324 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|