Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 2349982..2350688 | Replicon | chromosome |
| Accession | NZ_CP114551 | ||
| Organism | Xylella fastidiosa subsp. pauca strain OLI17A | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | Q9PAL4 |
| Locus tag | O4443_RS10790 | Protein ID | WP_010894925.1 |
| Coordinates | 2349982..2350284 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | - |
| Locus tag | O4443_RS10795 | Protein ID | WP_060872143.1 |
| Coordinates | 2350287..2350688 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4443_RS10765 (O4443_10765) | 2345140..2346318 | - | 1179 | WP_023907007.1 | phage tail sheath family protein | - |
| O4443_RS10770 (O4443_10770) | 2346383..2347975 | - | 1593 | WP_282454408.1 | hypothetical protein | - |
| O4443_RS10775 (O4443_10775) | 2347983..2348540 | - | 558 | WP_031336758.1 | phage tail protein I | - |
| O4443_RS10780 (O4443_10780) | 2348533..2349426 | - | 894 | WP_088372108.1 | baseplate J/gp47 family protein | - |
| O4443_RS10785 (O4443_10785) | 2349426..2349788 | - | 363 | WP_233242664.1 | GPW/gp25 family protein | - |
| O4443_RS10790 (O4443_10790) | 2349982..2350284 | + | 303 | WP_010894925.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
| O4443_RS10795 (O4443_10795) | 2350287..2350688 | + | 402 | WP_060872143.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| O4443_RS10800 (O4443_10800) | 2350757..2351344 | - | 588 | WP_088372104.1 | phage baseplate assembly protein V | - |
| O4443_RS10805 (O4443_10805) | 2351341..2351883 | - | 543 | WP_023907017.1 | hypothetical protein | - |
| O4443_RS10810 (O4443_10810) | 2351859..2352380 | - | 522 | WP_010893241.1 | hypothetical protein | - |
| O4443_RS10815 (O4443_10815) | 2352377..2352700 | - | 324 | WP_042462902.1 | hypothetical protein | - |
| O4443_RS10820 (O4443_10820) | 2352700..2352960 | - | 261 | WP_010893239.1 | hypothetical protein | - |
| O4443_RS10825 (O4443_10825) | 2352978..2354858 | - | 1881 | WP_088372102.1 | phage major capsid protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2339433..2372770 | 33337 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10958.74 Da Isoelectric Point: 8.0251
>T266719 WP_010894925.1 NZ_CP114551:2349982-2350284 [Xylella fastidiosa subsp. pauca]
MEKGTPHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCTVVLALTSADFYKSMTTYADHTVFQDVYHAKTASGD
EVYLKLTVIDDVLIVSFKEL
MEKGTPHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCTVVLALTSADFYKSMTTYADHTVFQDVYHAKTASGD
EVYLKLTVIDDVLIVSFKEL
Download Length: 303 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 15004.12 Da Isoelectric Point: 7.1650
>AT266719 WP_060872143.1 NZ_CP114551:2350287-2350688 [Xylella fastidiosa subsp. pauca]
MRCPCCGAAELIHDTRDMLYTYKSETTSIPTVTGDFCPACGEVVLDREHGDRYSELVGLFQRQVNSAYVDPGYITKVRRK
LDLDQRQAAELFGGGVNAFSRYENGKTKPPLSLVKLFKLLDRHPDLLNEVKSF
MRCPCCGAAELIHDTRDMLYTYKSETTSIPTVTGDFCPACGEVVLDREHGDRYSELVGLFQRQVNSAYVDPGYITKVRRK
LDLDQRQAAELFGGGVNAFSRYENGKTKPPLSLVKLFKLLDRHPDLLNEVKSF
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|