Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | sprA1-sprA1AS/- |
| Location | 1425800..1425980 | Replicon | chromosome |
| Accession | NC_017342 | ||
| Organism | Staphylococcus aureus subsp. aureus TCH60 | ||
Toxin (Protein)
| Gene name | sprA1 | Uniprot ID | - |
| Locus tag | HMPREF0772_RS15125 | Protein ID | WP_001801861.1 |
| Coordinates | 1425885..1425980 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | sprA1AS | ||
| Locus tag | - | ||
| Coordinates | 1425800..1425857 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HMPREF0772_RS07240 | 1421214..1423634 | - | 2421 | WP_000182551.1 | polysaccharide lyase 8 family protein | - |
| HMPREF0772_RS07245 | 1424159..1424601 | + | 443 | Protein_1338 | DUF1433 domain-containing protein | - |
| HMPREF0772_RS07250 | 1424601..1425044 | + | 444 | WP_000731421.1 | DUF1433 domain-containing protein | - |
| HMPREF0772_RS14630 | 1425044..1425486 | + | 443 | Protein_1340 | DUF1433 domain-containing protein | - |
| HMPREF0772_RS07260 | 1425661..1425762 | - | 102 | WP_001791232.1 | hypothetical protein | - |
| - | 1425800..1425857 | + | 58 | - | - | Antitoxin |
| HMPREF0772_RS15125 | 1425885..1425980 | - | 96 | WP_001801861.1 | type I toxin-antitoxin system Fst family toxin PepA1 | Toxin |
| HMPREF0772_RS07265 | 1426431..1426877 | + | 447 | WP_000747804.1 | DUF1433 domain-containing protein | - |
| HMPREF0772_RS07270 | 1427070..1427639 | + | 570 | WP_000125075.1 | ImmA/IrrE family metallo-endopeptidase | - |
| HMPREF0772_RS07275 | 1427639..1429006 | + | 1368 | WP_001093573.1 | FRG domain-containing protein | - |
| HMPREF0772_RS07280 | 1429155..1429727 | - | 573 | WP_000414222.1 | hypothetical protein | - |
| HMPREF0772_RS07285 | 1429825..1430169 | - | 345 | WP_000627550.1 | DUF3969 family protein | - |
| HMPREF0772_RS07290 | 1430210..1430836 | - | 627 | WP_000669038.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | selk / hysA | 1396045..1433395 | 37350 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3554.32 Da Isoelectric Point: 10.4449
>T26671 WP_001801861.1 NC_017342:c1425980-1425885 [Staphylococcus aureus subsp. aureus TCH60]
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
VMLIFVHIIAPVISGCAIAFFSYWLSRRNTK
Download Length: 96 bp
>T26671 NC_017342:c1425980-1425885 [Staphylococcus aureus subsp. aureus TCH60]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 58 bp
>AT26671 NC_017342:1425800-1425857 [Staphylococcus aureus subsp. aureus TCH60]
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
AACGAAAATAAGTATTTACTTATACACCAATCCCCTCACTATTTGCGGTAGTGAGGGG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|