Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
| Location | 2352321..2353027 | Replicon | chromosome |
| Accession | NZ_CP114550 | ||
| Organism | Xylella fastidiosa subsp. pauca strain AM2-Angelina | ||
Toxin (Protein)
| Gene name | mqsR | Uniprot ID | Q9PAL4 |
| Locus tag | O4445_RS10880 | Protein ID | WP_010894925.1 |
| Coordinates | 2352321..2352623 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | mqsA | Uniprot ID | - |
| Locus tag | O4445_RS10885 | Protein ID | WP_060872143.1 |
| Coordinates | 2352626..2353027 (+) | Length | 134 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| O4445_RS10855 (O4445_10855) | 2347479..2348657 | - | 1179 | WP_023907007.1 | phage tail sheath family protein | - |
| O4445_RS10860 (O4445_10860) | 2348722..2350314 | - | 1593 | WP_282454408.1 | hypothetical protein | - |
| O4445_RS10865 (O4445_10865) | 2350322..2350879 | - | 558 | WP_031336758.1 | phage tail protein I | - |
| O4445_RS10870 (O4445_10870) | 2350872..2351765 | - | 894 | WP_088372108.1 | baseplate J/gp47 family protein | - |
| O4445_RS10875 (O4445_10875) | 2351765..2352127 | - | 363 | WP_233242664.1 | GPW/gp25 family protein | - |
| O4445_RS10880 (O4445_10880) | 2352321..2352623 | + | 303 | WP_010894925.1 | type II toxin-antitoxin system MqsR family toxin | Toxin |
| O4445_RS10885 (O4445_10885) | 2352626..2353027 | + | 402 | WP_060872143.1 | type II toxin-antitoxin system MqsA family antitoxin | Antitoxin |
| O4445_RS10890 (O4445_10890) | 2353096..2353683 | - | 588 | WP_088372104.1 | phage baseplate assembly protein V | - |
| O4445_RS10895 (O4445_10895) | 2353680..2354222 | - | 543 | WP_023907017.1 | hypothetical protein | - |
| O4445_RS10900 (O4445_10900) | 2354198..2354719 | - | 522 | WP_010893241.1 | hypothetical protein | - |
| O4445_RS10905 (O4445_10905) | 2354716..2355039 | - | 324 | WP_042462902.1 | hypothetical protein | - |
| O4445_RS10910 (O4445_10910) | 2355039..2355299 | - | 261 | WP_010893239.1 | hypothetical protein | - |
| O4445_RS10915 (O4445_10915) | 2355317..2357197 | - | 1881 | WP_088372102.1 | phage major capsid protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2341772..2384671 | 42899 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 10958.74 Da Isoelectric Point: 8.0251
>T266707 WP_010894925.1 NZ_CP114550:2352321-2352623 [Xylella fastidiosa subsp. pauca]
MEKGTPHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCTVVLALTSADFYKSMTTYADHTVFQDVYHAKTASGD
EVYLKLTVIDDVLIVSFKEL
MEKGTPHYKLPVVKALVKAGKVRATATAYQGARELGIKDLTGMCTVVLALTSADFYKSMTTYADHTVFQDVYHAKTASGD
EVYLKLTVIDDVLIVSFKEL
Download Length: 303 bp
Antitoxin
Download Length: 134 a.a. Molecular weight: 15004.12 Da Isoelectric Point: 7.1650
>AT266707 WP_060872143.1 NZ_CP114550:2352626-2353027 [Xylella fastidiosa subsp. pauca]
MRCPCCGAAELIHDTRDMLYTYKSETTSIPTVTGDFCPACGEVVLDREHGDRYSELVGLFQRQVNSAYVDPGYITKVRRK
LDLDQRQAAELFGGGVNAFSRYENGKTKPPLSLVKLFKLLDRHPDLLNEVKSF
MRCPCCGAAELIHDTRDMLYTYKSETTSIPTVTGDFCPACGEVVLDREHGDRYSELVGLFQRQVNSAYVDPGYITKVRRK
LDLDQRQAAELFGGGVNAFSRYENGKTKPPLSLVKLFKLLDRHPDLLNEVKSF
Download Length: 402 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|